BLASTX nr result
ID: Phellodendron21_contig00020294
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020294 (518 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KXL48858.1 hypothetical protein FE78DRAFT_180177 [Acidomyces ric... 71 2e-12 XP_016764341.1 S10_plectin-domain-containing protein [Sphaerulin... 71 3e-12 XP_007677563.1 hypothetical protein BAUCODRAFT_72390 [Baudoinia ... 71 3e-12 XP_007922124.1 hypothetical protein MYCFIDRAFT_160741 [Pseudocer... 71 3e-12 KJX98998.1 40S ribosomal protein S10 [Zymoseptoria brevis] 71 3e-12 EME48493.1 hypothetical protein DOTSEDRAFT_67508 [Dothistroma se... 71 3e-12 XP_003852885.1 hypothetical protein MYCGRDRAFT_104063 [Zymosepto... 71 3e-12 KEQ83515.1 hypothetical protein M438DRAFT_247646, partial [Aureo... 70 3e-12 KEQ60533.1 hypothetical protein M437DRAFT_54391 [Aureobasidium m... 70 3e-12 KYG48880.1 hypothetical protein M433DRAFT_131766 [Acidomyces ric... 71 3e-12 OCK92018.1 40S ribosomal protein S10b [Cenococcum geophilum 1.58] 70 4e-12 XP_007783352.1 hypothetical protein W97_07183 [Coniosporium apol... 70 4e-12 OCK74273.1 hypothetical protein K432DRAFT_259779, partial [Lepid... 70 4e-12 GAM84619.1 hypothetical protein ANO11243_026150 [fungal sp. No.1... 70 4e-12 OCL13319.1 hypothetical protein AOQ84DRAFT_114563 [Glonium stell... 70 4e-12 XP_020132291.1 small subunit ribosomal protein s10e [Diplodia co... 70 4e-12 EKG10989.1 Plectin/S10 [Macrophomina phaseolina MS6] 70 4e-12 KKY13666.1 putative 40s ribosomal protein s10-a [Diplodia seriata] 70 4e-12 XP_007587847.1 putative 40s ribosomal protein s10-a protein [Neo... 70 5e-12 OMP85478.1 40S ribosomal protein S10-B [Diplodia seriata] 70 5e-12 >KXL48858.1 hypothetical protein FE78DRAFT_180177 [Acidomyces richmondensis] Length = 161 Score = 70.9 bits (172), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 101 >XP_016764341.1 S10_plectin-domain-containing protein [Sphaerulina musiva SO2202] EMF16220.1 S10_plectin-domain-containing protein [Sphaerulina musiva SO2202] Length = 168 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 101 >XP_007677563.1 hypothetical protein BAUCODRAFT_72390 [Baudoinia panamericana UAMH 10762] EMC95068.1 hypothetical protein BAUCODRAFT_72390 [Baudoinia panamericana UAMH 10762] Length = 168 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 101 >XP_007922124.1 hypothetical protein MYCFIDRAFT_160741 [Pseudocercospora fijiensis CIRAD86] EME89533.1 hypothetical protein MYCFIDRAFT_160741 [Pseudocercospora fijiensis CIRAD86] Length = 169 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 101 >KJX98998.1 40S ribosomal protein S10 [Zymoseptoria brevis] Length = 171 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 101 >EME48493.1 hypothetical protein DOTSEDRAFT_67508 [Dothistroma septosporum NZE10] Length = 171 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 101 >XP_003852885.1 hypothetical protein MYCGRDRAFT_104063 [Zymoseptoria tritici IPO323] EGP87861.1 hypothetical protein MYCGRDRAFT_104063 [Zymoseptoria tritici IPO323] Length = 171 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 101 >KEQ83515.1 hypothetical protein M438DRAFT_247646, partial [Aureobasidium pullulans EXF-150] Length = 156 Score = 70.5 bits (171), Expect = 3e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 101 >KEQ60533.1 hypothetical protein M437DRAFT_54391 [Aureobasidium melanogenum CBS 110374] Length = 162 Score = 70.5 bits (171), Expect = 3e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 101 >KYG48880.1 hypothetical protein M433DRAFT_131766 [Acidomyces richmondensis BFW] Length = 180 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP Sbjct: 90 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 120 >OCK92018.1 40S ribosomal protein S10b [Cenococcum geophilum 1.58] Length = 164 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 101 >XP_007783352.1 hypothetical protein W97_07183 [Coniosporium apollinis CBS 100218] EON68035.1 hypothetical protein W97_07183 [Coniosporium apollinis CBS 100218] Length = 164 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 72 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 102 >OCK74273.1 hypothetical protein K432DRAFT_259779, partial [Lepidopterella palustris CBS 459.81] Length = 166 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 70 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 100 >GAM84619.1 hypothetical protein ANO11243_026150 [fungal sp. No.11243] Length = 166 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 73 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 103 >OCL13319.1 hypothetical protein AOQ84DRAFT_114563 [Glonium stellatum] Length = 167 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 71 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 101 >XP_020132291.1 small subunit ribosomal protein s10e [Diplodia corticola] OJD36031.1 small subunit ribosomal protein s10e [Diplodia corticola] Length = 170 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 80 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 110 >EKG10989.1 Plectin/S10 [Macrophomina phaseolina MS6] Length = 171 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 80 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 110 >KKY13666.1 putative 40s ribosomal protein s10-a [Diplodia seriata] Length = 172 Score = 70.5 bits (171), Expect = 4e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 82 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 112 >XP_007587847.1 putative 40s ribosomal protein s10-a protein [Neofusicoccum parvum UCRNP2] EOD44688.1 putative 40s ribosomal protein s10-a protein [Neofusicoccum parvum UCRNP2] Length = 178 Score = 70.5 bits (171), Expect = 5e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 87 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 117 >OMP85478.1 40S ribosomal protein S10-B [Diplodia seriata] Length = 180 Score = 70.5 bits (171), Expect = 5e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 518 EGLDYLREWLHLPAEIVPQTHVKQQRSHAPP 426 EGLDYLREWLHLPAEIVPQTH+KQQRSHAPP Sbjct: 90 EGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 120