BLASTX nr result
ID: Phellodendron21_contig00020273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020273 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006422760.1 hypothetical protein CICLE_v10029689mg [Citrus cl... 61 9e-10 >XP_006422760.1 hypothetical protein CICLE_v10029689mg [Citrus clementina] XP_006486889.1 PREDICTED: phytosulfokines [Citrus sinensis] ESR36000.1 hypothetical protein CICLE_v10029689mg [Citrus clementina] KDO49548.1 hypothetical protein CISIN_1g034623mg [Citrus sinensis] Length = 89 Score = 61.2 bits (147), Expect = 9e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 67 QASATRPEPAFSDVTPLKNQHGDVQEATENKVDQTVE 177 QASA RPEPAF DVTPLKN HGDV+EAT+ KVDQTVE Sbjct: 23 QASAIRPEPAFPDVTPLKNLHGDVEEATK-KVDQTVE 58