BLASTX nr result
ID: Phellodendron21_contig00019867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00019867 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007408730.1 hypothetical protein MELLADRAFT_47963 [Melampsora... 67 9e-11 >XP_007408730.1 hypothetical protein MELLADRAFT_47963 [Melampsora larici-populina 98AG31] EGG07965.1 hypothetical protein MELLADRAFT_47963 [Melampsora larici-populina 98AG31] Length = 408 Score = 66.6 bits (161), Expect = 9e-11 Identities = 44/101 (43%), Positives = 49/101 (48%), Gaps = 3/101 (2%) Frame = +1 Query: 1 LEYFLGTAKAVRAMHRYXXXXXXXXXXXXXXXI---SYPPSGSTKSLETVVFSPSMGTSP 171 L YF+GT KAVRAMHRY SYPPSGS K+L VV SPS+ SP Sbjct: 147 LGYFIGTLKAVRAMHRYTPNKKPTTNHTTETTSDSSSYPPSGSPKNLGNVVSSPSIVISP 206 Query: 172 TNSSSPTQHDLRXXXXXXXXXXXXXXXXHMQAPLMGELSSH 294 + SSSP D +APLMG LSSH Sbjct: 207 STSSSPIHDD---EDDDEEEQMGKTEEEQQEAPLMGNLSSH 244