BLASTX nr result
ID: Phellodendron21_contig00019793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00019793 (738 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007406690.1 hypothetical protein MELLADRAFT_71039 [Melampsora... 113 2e-25 OAV87881.1 hypothetical protein PTTG_06773 [Puccinia triticina 1... 65 2e-08 XP_003335705.1 hypothetical protein PGTG_17143 [Puccinia gramini... 60 5e-07 >XP_007406690.1 hypothetical protein MELLADRAFT_71039 [Melampsora larici-populina 98AG31] EGG10389.1 hypothetical protein MELLADRAFT_71039 [Melampsora larici-populina 98AG31] Length = 452 Score = 113 bits (282), Expect = 2e-25 Identities = 56/96 (58%), Positives = 64/96 (66%) Frame = +1 Query: 1 LASCFVILFATVGVEHELKWVMSLYYLVWALAGTFLCYEIVKIYPRAVEYNNQRSFIXXX 180 L SCFV+L A+V VE ELKW+M+LYYLVW LA TFLCYEI KIYP+A E + QRSFI Sbjct: 325 LVSCFVVLLASVAVERELKWIMALYYLVWTLAMTFLCYEIAKIYPKATEAHIQRSFILFA 384 Query: 181 XXXXXXXXXXXICSIPCWLNFGKGLKEARIRSAWLA 288 + SI C NFG GLKE R+RS W A Sbjct: 385 SLTFVMLLSTGVFSIICCCNFGIGLKERRLRSPWSA 420 >OAV87881.1 hypothetical protein PTTG_06773 [Puccinia triticina 1-1 BBBD Race 1] Length = 388 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/88 (38%), Positives = 52/88 (59%) Frame = +1 Query: 1 LASCFVILFATVGVEHELKWVMSLYYLVWALAGTFLCYEIVKIYPRAVEYNNQRSFIXXX 180 +A+C V LFA++ VE EL++ + LY + W+ A F+ YEI++I+P + ++Q S I Sbjct: 265 VATCLVQLFASIAVELELRFFIFLYGMFWSAAMLFMGYEIIEIHPLSEATDSQHSLILFS 324 Query: 181 XXXXXXXXXXXICSIPCWLNFGKGLKEA 264 I SI C++NF KGLK A Sbjct: 325 SLTILLLFSTGIMSIFCFMNFNKGLKGA 352 >XP_003335705.1 hypothetical protein PGTG_17143 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP91286.1 hypothetical protein PGTG_17143 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 390 Score = 60.5 bits (145), Expect = 5e-07 Identities = 32/85 (37%), Positives = 49/85 (57%) Frame = +1 Query: 4 ASCFVILFATVGVEHELKWVMSLYYLVWALAGTFLCYEIVKIYPRAVEYNNQRSFIXXXX 183 A+C V LFA++ VE EL+ + LY + W+ A F+ YEI++++P + ++Q S I Sbjct: 268 ATCLVQLFASIAVELELRPFIFLYGIFWSAAMMFMGYEIIELHPISEATDSQHSLILFSS 327 Query: 184 XXXXXXXXXXICSIPCWLNFGKGLK 258 I SI C++NF KGLK Sbjct: 328 LTILLLFSTGIVSIFCFMNFNKGLK 352