BLASTX nr result
ID: Phellodendron21_contig00019703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00019703 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO59440.1 hypothetical protein CISIN_1g0057191mg [Citrus sinensis] 103 3e-23 XP_006473989.1 PREDICTED: two-component response regulator ORR24... 103 3e-23 XP_006453634.1 hypothetical protein CICLE_v10007648mg [Citrus cl... 102 9e-23 XP_011017981.1 PREDICTED: two-component response regulator ARR12... 99 1e-21 CBM42562.1 putative B-type response regulator 19 [Populus x cana... 99 1e-21 XP_011017979.1 PREDICTED: two-component response regulator ARR12... 99 1e-21 XP_002325148.2 hypothetical protein POPTR_0018s11960g [Populus t... 99 1e-21 KCW78951.1 hypothetical protein EUGRSUZ_C00380 [Eucalyptus grandis] 98 2e-21 XP_011033470.1 PREDICTED: two-component response regulator ARR12... 98 2e-21 OAY31804.1 hypothetical protein MANES_14G141800 [Manihot esculenta] 98 2e-21 XP_002308388.2 hypothetical protein POPTR_0006s20220g [Populus t... 98 2e-21 XP_010047141.1 PREDICTED: two-component response regulator ORR24... 98 2e-21 CDI06884.1 response regulator [Populus x canadensis] 98 2e-21 OAY31803.1 hypothetical protein MANES_14G141800 [Manihot esculenta] 98 2e-21 OAY31805.1 hypothetical protein MANES_14G141800 [Manihot esculenta] 98 2e-21 ACU18532.1 unknown, partial [Glycine max] 94 3e-21 XP_016188779.1 PREDICTED: two-component response regulator ARR12... 97 4e-21 XP_015954155.1 PREDICTED: two-component response regulator ARR12... 97 4e-21 XP_016188778.1 PREDICTED: two-component response regulator ARR12... 97 4e-21 XP_015954153.1 PREDICTED: two-component response regulator ARR12... 97 4e-21 >KDO59440.1 hypothetical protein CISIN_1g0057191mg [Citrus sinensis] Length = 681 Score = 103 bits (256), Expect = 3e-23 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FPIGMRVLAVDDDPTCLKVLEN+LR CQYEVTVTNQAV ALKMLRENRN +DLV Sbjct: 20 FPIGMRVLAVDDDPTCLKVLENFLRACQYEVTVTNQAVTALKMLRENRNNFDLV 73 >XP_006473989.1 PREDICTED: two-component response regulator ORR24 [Citrus sinensis] Length = 681 Score = 103 bits (256), Expect = 3e-23 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FPIGMRVLAVDDDPTCLKVLEN+LR CQYEVTVTNQAV ALKMLRENRN +DLV Sbjct: 20 FPIGMRVLAVDDDPTCLKVLENFLRACQYEVTVTNQAVTALKMLRENRNNFDLV 73 >XP_006453634.1 hypothetical protein CICLE_v10007648mg [Citrus clementina] ESR66874.1 hypothetical protein CICLE_v10007648mg [Citrus clementina] Length = 681 Score = 102 bits (253), Expect = 9e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FPIGMRVLAVDDDPTCLKVLEN+LR CQYEVTVTNQAV ALK+LRENRN +DLV Sbjct: 20 FPIGMRVLAVDDDPTCLKVLENFLRACQYEVTVTNQAVTALKLLRENRNNFDLV 73 >XP_011017981.1 PREDICTED: two-component response regulator ARR12 isoform X2 [Populus euphratica] Length = 672 Score = 98.6 bits (244), Expect = 1e-21 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDP CLKVLEN LR CQYEVT TNQAV AL+MLRENRNKYDLV Sbjct: 17 FPVGMRVLAVDDDPICLKVLENLLRKCQYEVTTTNQAVTALEMLRENRNKYDLV 70 >CBM42562.1 putative B-type response regulator 19 [Populus x canadensis] Length = 685 Score = 98.6 bits (244), Expect = 1e-21 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDP CLKVLEN LR CQYEVT TNQAV AL+MLRENRNKYDLV Sbjct: 17 FPVGMRVLAVDDDPICLKVLENLLRKCQYEVTTTNQAVTALEMLRENRNKYDLV 70 >XP_011017979.1 PREDICTED: two-component response regulator ARR12 isoform X1 [Populus euphratica] Length = 707 Score = 98.6 bits (244), Expect = 1e-21 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDP CLKVLEN LR CQYEVT TNQAV AL+MLRENRNKYDLV Sbjct: 17 FPVGMRVLAVDDDPICLKVLENLLRKCQYEVTTTNQAVTALEMLRENRNKYDLV 70 >XP_002325148.2 hypothetical protein POPTR_0018s11960g [Populus trichocarpa] EEF03713.2 hypothetical protein POPTR_0018s11960g [Populus trichocarpa] Length = 707 Score = 98.6 bits (244), Expect = 1e-21 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDP CLKVLEN LR CQYEVT TNQAV AL+MLRENRNKYDLV Sbjct: 17 FPVGMRVLAVDDDPICLKVLENLLRKCQYEVTTTNQAVTALEMLRENRNKYDLV 70 >KCW78951.1 hypothetical protein EUGRSUZ_C00380 [Eucalyptus grandis] Length = 676 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDPTCLKVLEN LR CQY+VT TNQA++ALKMLRENR+K+DLV Sbjct: 11 FPVGMRVLAVDDDPTCLKVLENLLRSCQYQVTTTNQAIMALKMLRENRDKFDLV 64 >XP_011033470.1 PREDICTED: two-component response regulator ARR12-like [Populus euphratica] Length = 680 Score = 98.2 bits (243), Expect = 2e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMR+LAVDDDP CLKVLEN LR CQYEVT TNQAV AL+MLRENRNKYDLV Sbjct: 18 FPVGMRILAVDDDPICLKVLENLLRKCQYEVTTTNQAVTALEMLRENRNKYDLV 71 >OAY31804.1 hypothetical protein MANES_14G141800 [Manihot esculenta] Length = 681 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMR+LAVDDDP CLKVLEN LR CQY+VT TNQA+ ALKMLRENRNKYDLV Sbjct: 16 FPVGMRILAVDDDPICLKVLENLLRKCQYQVTTTNQAITALKMLRENRNKYDLV 69 >XP_002308388.2 hypothetical protein POPTR_0006s20220g [Populus trichocarpa] EEE91911.2 hypothetical protein POPTR_0006s20220g [Populus trichocarpa] Length = 683 Score = 98.2 bits (243), Expect = 2e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMR+LAVDDDP CLKVLEN LR CQYEVT TNQAV AL+MLRENRNKYDLV Sbjct: 18 FPVGMRILAVDDDPICLKVLENLLRKCQYEVTTTNQAVTALEMLRENRNKYDLV 71 >XP_010047141.1 PREDICTED: two-component response regulator ORR24 [Eucalyptus grandis] KCW78950.1 hypothetical protein EUGRSUZ_C00380 [Eucalyptus grandis] Length = 688 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDPTCLKVLEN LR CQY+VT TNQA++ALKMLRENR+K+DLV Sbjct: 11 FPVGMRVLAVDDDPTCLKVLENLLRSCQYQVTTTNQAIMALKMLRENRDKFDLV 64 >CDI06884.1 response regulator [Populus x canadensis] Length = 691 Score = 98.2 bits (243), Expect = 2e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMR+LAVDDDP CLKVLEN LR CQYEVT TNQAV AL+MLRENRNKYDLV Sbjct: 17 FPVGMRILAVDDDPICLKVLENLLRKCQYEVTTTNQAVTALEMLRENRNKYDLV 70 >OAY31803.1 hypothetical protein MANES_14G141800 [Manihot esculenta] Length = 698 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMR+LAVDDDP CLKVLEN LR CQY+VT TNQA+ ALKMLRENRNKYDLV Sbjct: 16 FPVGMRILAVDDDPICLKVLENLLRKCQYQVTTTNQAITALKMLRENRNKYDLV 69 >OAY31805.1 hypothetical protein MANES_14G141800 [Manihot esculenta] Length = 699 Score = 98.2 bits (243), Expect = 2e-21 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMR+LAVDDDP CLKVLEN LR CQY+VT TNQA+ ALKMLRENRNKYDLV Sbjct: 16 FPVGMRILAVDDDPICLKVLENLLRKCQYQVTTTNQAITALKMLRENRNKYDLV 69 >ACU18532.1 unknown, partial [Glycine max] Length = 220 Score = 93.6 bits (231), Expect = 3e-21 Identities = 45/54 (83%), Positives = 47/54 (87%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDP CLKVLEN LR CQY VT TNQAV AL MLRENRNK+DLV Sbjct: 15 FPVGMRVLAVDDDPICLKVLENLLRKCQYHVTTTNQAVEALTMLRENRNKFDLV 68 >XP_016188779.1 PREDICTED: two-component response regulator ARR12-like isoform X2 [Arachis ipaensis] Length = 683 Score = 97.4 bits (241), Expect = 4e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDPTCLKVLEN LR CQY+VT TNQA+ AL+MLRENRNK+DLV Sbjct: 10 FPVGMRVLAVDDDPTCLKVLENLLRKCQYQVTTTNQAIEALRMLRENRNKFDLV 63 >XP_015954155.1 PREDICTED: two-component response regulator ARR12 isoform X2 [Arachis duranensis] Length = 683 Score = 97.4 bits (241), Expect = 4e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDPTCLKVLEN LR CQY+VT TNQA+ AL+MLRENRNK+DLV Sbjct: 10 FPVGMRVLAVDDDPTCLKVLENLLRKCQYQVTTTNQAIEALRMLRENRNKFDLV 63 >XP_016188778.1 PREDICTED: two-component response regulator ARR12-like isoform X1 [Arachis ipaensis] Length = 687 Score = 97.4 bits (241), Expect = 4e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDPTCLKVLEN LR CQY+VT TNQA+ AL+MLRENRNK+DLV Sbjct: 10 FPVGMRVLAVDDDPTCLKVLENLLRKCQYQVTTTNQAIEALRMLRENRNKFDLV 63 >XP_015954153.1 PREDICTED: two-component response regulator ARR12 isoform X1 [Arachis duranensis] Length = 687 Score = 97.4 bits (241), Expect = 4e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 164 FPIGMRVLAVDDDPTCLKVLENYLRVCQYEVTVTNQAVIALKMLRENRNKYDLV 3 FP+GMRVLAVDDDPTCLKVLEN LR CQY+VT TNQA+ AL+MLRENRNK+DLV Sbjct: 10 FPVGMRVLAVDDDPTCLKVLENLLRKCQYQVTTTNQAIEALRMLRENRNKFDLV 63