BLASTX nr result
ID: Phellodendron21_contig00019541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00019541 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO68486.1 hypothetical protein CISIN_1g0333182mg, partial [Citr... 67 5e-13 XP_006443877.1 hypothetical protein CICLE_v10022892mg [Citrus cl... 67 3e-12 XP_006443876.1 hypothetical protein CICLE_v10022892mg [Citrus cl... 67 3e-12 XP_004289916.1 PREDICTED: bet1-like SNARE 1-1 [Fragaria vesca su... 64 6e-11 XP_007200626.1 hypothetical protein PRUPE_ppa013434mg [Prunus pe... 61 5e-10 XP_016724968.1 PREDICTED: bet1-like SNARE 1-1 [Gossypium hirsutum] 61 6e-10 XP_012442630.1 PREDICTED: bet1-like SNARE 1-1 isoform X2 [Gossyp... 61 7e-10 XP_017640238.1 PREDICTED: bet1-like SNARE 1-1 [Gossypium arboreu... 61 7e-10 XP_018825210.1 PREDICTED: bet1-like SNARE 1-1 [Juglans regia] XP... 60 1e-09 OMP09319.1 hypothetical protein COLO4_05595 [Corchorus olitorius] 60 1e-09 OMO78427.1 hypothetical protein CCACVL1_14381 [Corchorus capsula... 60 2e-09 XP_009367711.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschne... 60 2e-09 XP_017983740.1 PREDICTED: bet1-like SNARE 1-1 isoform X1 [Theobr... 60 2e-09 XP_015575886.1 PREDICTED: bet1-like SNARE 1-1 [Ricinus communis]... 59 4e-09 KJB42238.1 hypothetical protein B456_007G144100 [Gossypium raimo... 59 5e-09 XP_016708603.1 PREDICTED: bet1-like SNARE 1-1 isoform X1 [Gossyp... 59 5e-09 XP_016708330.1 PREDICTED: bet1-like SNARE 1-1 [Gossypium hirsutum] 59 5e-09 XP_012490671.1 PREDICTED: bet1-like SNARE 1-1 isoform X1 [Gossyp... 59 5e-09 XP_009354921.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschne... 59 5e-09 KHG02866.1 Bet1-like SNARE 1-1 [Gossypium arboreum] 59 8e-09 >KDO68486.1 hypothetical protein CISIN_1g0333182mg, partial [Citrus sinensis] Length = 54 Score = 67.0 bits (162), Expect = 5e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MNSRRDYRNSKV LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNSRRDYRNSKVALFDGIEEGGIRASSSYSHEI 33 >XP_006443877.1 hypothetical protein CICLE_v10022892mg [Citrus clementina] ESR57117.1 hypothetical protein CICLE_v10022892mg [Citrus clementina] Length = 122 Score = 67.0 bits (162), Expect = 3e-12 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MNSRRDYRNSKV LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNSRRDYRNSKVALFDGIEEGGIRASSSYSHEI 33 >XP_006443876.1 hypothetical protein CICLE_v10022892mg [Citrus clementina] XP_006443878.1 hypothetical protein CICLE_v10022892mg [Citrus clementina] XP_006479564.1 PREDICTED: bet1-like SNARE 1-1 [Citrus sinensis] ESR57116.1 hypothetical protein CICLE_v10022892mg [Citrus clementina] ESR57118.1 hypothetical protein CICLE_v10022892mg [Citrus clementina] Length = 122 Score = 67.0 bits (162), Expect = 3e-12 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MNSRRDYRNSKV LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNSRRDYRNSKVALFDGIEEGGIRASSSYSHEI 33 >XP_004289916.1 PREDICTED: bet1-like SNARE 1-1 [Fragaria vesca subsp. vesca] Length = 122 Score = 63.5 bits (153), Expect = 6e-11 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN+RRDYRN+KV LFDGIEEGGIRAS+SYSHEI Sbjct: 1 MNARRDYRNNKVALFDGIEEGGIRASASYSHEI 33 >XP_007200626.1 hypothetical protein PRUPE_ppa013434mg [Prunus persica] XP_008235716.1 PREDICTED: bet1-like SNARE 1-1 [Prunus mume] XP_008235717.1 PREDICTED: bet1-like SNARE 1-1 [Prunus mume] ONH93349.1 hypothetical protein PRUPE_8G227800 [Prunus persica] Length = 122 Score = 61.2 bits (147), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN+RRDYR +KV LFDGIEEGGIRAS+SYSHEI Sbjct: 1 MNARRDYRGNKVALFDGIEEGGIRASASYSHEI 33 >XP_016724968.1 PREDICTED: bet1-like SNARE 1-1 [Gossypium hirsutum] Length = 118 Score = 60.8 bits (146), Expect = 6e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RNS+V LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNPRRDMRNSRVALFDGIEEGGIRASSSYSHEI 33 >XP_012442630.1 PREDICTED: bet1-like SNARE 1-1 isoform X2 [Gossypium raimondii] KJB11283.1 hypothetical protein B456_001G251400 [Gossypium raimondii] Length = 122 Score = 60.8 bits (146), Expect = 7e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RNS+V LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNPRRDMRNSRVALFDGIEEGGIRASSSYSHEI 33 >XP_017640238.1 PREDICTED: bet1-like SNARE 1-1 [Gossypium arboreum] KHG17403.1 Bet1-like SNARE 1-1 [Gossypium arboreum] Length = 122 Score = 60.8 bits (146), Expect = 7e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RNS+V LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNPRRDMRNSRVALFDGIEEGGIRASSSYSHEI 33 >XP_018825210.1 PREDICTED: bet1-like SNARE 1-1 [Juglans regia] XP_018825211.1 PREDICTED: bet1-like SNARE 1-1 [Juglans regia] Length = 122 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN+RRD+RN+K LFDGIEEGGI+ASSSYSHEI Sbjct: 1 MNARRDFRNNKTALFDGIEEGGIKASSSYSHEI 33 >OMP09319.1 hypothetical protein COLO4_05595 [Corchorus olitorius] Length = 107 Score = 59.7 bits (143), Expect = 1e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRASSSYSHEI 33 >OMO78427.1 hypothetical protein CCACVL1_14381 [Corchorus capsularis] Length = 122 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRASSSYSHEI 33 >XP_009367711.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschneideri] XP_009367712.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschneideri] XP_009379297.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschneideri] XP_009379298.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschneideri] XP_018505391.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschneideri] XP_018507962.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschneideri] Length = 122 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN+RRD+R +KV LFDGIEEGGIRAS+SYSHEI Sbjct: 1 MNARRDFRGNKVALFDGIEEGGIRASASYSHEI 33 >XP_017983740.1 PREDICTED: bet1-like SNARE 1-1 isoform X1 [Theobroma cacao] EOX94518.1 BET1P/SFT1P-like protein 14A isoform 1 [Theobroma cacao] Length = 122 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRASSSYSHEI 33 >XP_015575886.1 PREDICTED: bet1-like SNARE 1-1 [Ricinus communis] XP_002521019.2 PREDICTED: bet1-like SNARE 1-1 [Ricinus communis] XP_015575887.1 PREDICTED: bet1-like SNARE 1-1 [Ricinus communis] Length = 122 Score = 58.9 bits (141), Expect = 4e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MNSRRD R S+ LFDGIEEGGIRASSSYSHEI Sbjct: 1 MNSRRDVRTSRTALFDGIEEGGIRASSSYSHEI 33 >KJB42238.1 hypothetical protein B456_007G144100 [Gossypium raimondii] Length = 121 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRA+SSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRATSSYSHEI 33 >XP_016708603.1 PREDICTED: bet1-like SNARE 1-1 isoform X1 [Gossypium hirsutum] Length = 122 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRA+SSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRATSSYSHEI 33 >XP_016708330.1 PREDICTED: bet1-like SNARE 1-1 [Gossypium hirsutum] Length = 122 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRA+SSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRATSSYSHEI 33 >XP_012490671.1 PREDICTED: bet1-like SNARE 1-1 isoform X1 [Gossypium raimondii] XP_017612526.1 PREDICTED: bet1-like SNARE 1-1 [Gossypium arboreum] Length = 122 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRA+SSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRATSSYSHEI 33 >XP_009354921.1 PREDICTED: bet1-like SNARE 1-1 [Pyrus x bretschneideri] ACD62528.1 bet1-like snare 1-1 [Malus domestica] Length = 122 Score = 58.5 bits (140), Expect = 5e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN+RRD+R +KV LFDGIEEGGIR+S+SYSHEI Sbjct: 1 MNARRDFRGNKVALFDGIEEGGIRSSASYSHEI 33 >KHG02866.1 Bet1-like SNARE 1-1 [Gossypium arboreum] Length = 141 Score = 58.5 bits (140), Expect = 8e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 101 MNSRRDYRNSKVQLFDGIEEGGIRASSSYSHEI 3 MN RRD RN++V LFDGIEEGGIRA+SSYSHEI Sbjct: 1 MNPRRDMRNNRVALFDGIEEGGIRATSSYSHEI 33