BLASTX nr result
ID: Phellodendron21_contig00019519
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00019519 (454 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006445060.1 hypothetical protein CICLE_v10020258mg [Citrus cl... 69 1e-10 GAV92035.1 hypothetical protein CFOL_v3_35419 [Cephalotus follic... 58 4e-08 XP_006492881.1 PREDICTED: riboflavin biosynthesis protein PYRD, ... 60 1e-07 XP_007219384.1 hypothetical protein PRUPE_ppa020208mg [Prunus pe... 58 6e-07 ONI22172.1 hypothetical protein PRUPE_2G112100 [Prunus persica] 58 6e-07 XP_008232259.1 PREDICTED: riboflavin biosynthesis protein PYRD, ... 58 6e-07 GAV81048.1 dCMP_cyt_deam_1 domain-containing protein, partial [C... 56 3e-06 XP_017186245.1 PREDICTED: riboflavin biosynthesis protein PYRD, ... 55 7e-06 XP_009336838.1 PREDICTED: riboflavin biosynthesis protein PYRD, ... 54 1e-05 >XP_006445060.1 hypothetical protein CICLE_v10020258mg [Citrus clementina] XP_006491085.1 PREDICTED: riboflavin biosynthesis protein PYRD, chloroplastic isoform X1 [Citrus sinensis] ESR58300.1 hypothetical protein CICLE_v10020258mg [Citrus clementina] KDO86140.1 hypothetical protein CISIN_1g014311mg [Citrus sinensis] Length = 427 Score = 68.6 bits (166), Expect = 1e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGY 323 E+LP+W+ SDGGN H LLNSL K L +K LQPKMSSQSIVLEGY Sbjct: 383 EVLPVWNGSDGGNPHTLLNSLGKRLILKNLQPKMSSQSIVLEGY 426 >GAV92035.1 hypothetical protein CFOL_v3_35419 [Cephalotus follicularis] Length = 104 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGYF 320 E+LP+WSES+ G H +LNSL K LK+K LQP++S+QS+ +EGYF Sbjct: 61 EVLPVWSESESGFPH-VLNSLGKRLKLKSLQPEISNQSVFIEGYF 104 >XP_006492881.1 PREDICTED: riboflavin biosynthesis protein PYRD, chloroplastic-like [Citrus sinensis] Length = 427 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGY 323 E+LP+W ES G + HALL+S+ K LK+K LQPK+SS S VLEGY Sbjct: 383 EVLPVWKESHGRDPHALLDSIGKGLKVKNLQPKISSHSTVLEGY 426 >XP_007219384.1 hypothetical protein PRUPE_ppa020208mg [Prunus persica] Length = 423 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGY 323 E+LP+W +DGGN L SLRK L++K L+PK+SS+++VLEGY Sbjct: 379 EVLPLWEANDGGNFPIALKSLRKRLEVKNLKPKVSSENVVLEGY 422 >ONI22172.1 hypothetical protein PRUPE_2G112100 [Prunus persica] Length = 425 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGY 323 E+LP+W +DGGN L SLRK L++K L+PK+SS+++VLEGY Sbjct: 381 EVLPLWEANDGGNFPIALKSLRKRLEVKNLKPKVSSENVVLEGY 424 >XP_008232259.1 PREDICTED: riboflavin biosynthesis protein PYRD, chloroplastic [Prunus mume] Length = 425 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGY 323 E+LP+W +DGGN L SLRK L++K L+PK+SS+++VLEGY Sbjct: 381 EVLPLWDANDGGNFPIALKSLRKRLEVKNLKPKVSSENVVLEGY 424 >GAV81048.1 dCMP_cyt_deam_1 domain-containing protein, partial [Cephalotus follicularis] Length = 462 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGYF 320 E+LP+WSES+ G +LNSL + LK+K LQPK S+QS+++EGYF Sbjct: 419 EVLPVWSESESG-FPLVLNSLGERLKLKSLQPKFSNQSVLVEGYF 462 >XP_017186245.1 PREDICTED: riboflavin biosynthesis protein PYRD, chloroplastic-like [Malus domestica] Length = 425 Score = 54.7 bits (130), Expect = 7e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGY 323 E+LP+W E+D GN L L K LK++ LQPK+S++S+VLEGY Sbjct: 381 EVLPLWDENDVGNFPVALKDLSKRLKVENLQPKISNESVVLEGY 424 >XP_009336838.1 PREDICTED: riboflavin biosynthesis protein PYRD, chloroplastic-like [Pyrus x bretschneideri] Length = 425 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -1 Query: 454 EILPIWSESDGGNLHALLNSLRKDLKMKILQPKMSSQSIVLEGY 323 E+LP+W E+D GN L SL K +++K LQPK+S++++VLEGY Sbjct: 381 EVLPLWDENDVGNFPVALKSLSKRVELKNLQPKISNENVVLEGY 424