BLASTX nr result
ID: Phellodendron21_contig00019112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00019112 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO67836.1 hypothetical protein CISIN_1g041503mg [Citrus sinensis] 52 3e-06 >KDO67836.1 hypothetical protein CISIN_1g041503mg [Citrus sinensis] Length = 99 Score = 51.6 bits (122), Expect = 3e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -2 Query: 333 TSHTPKNPNRKFWK*EKCLDFEWVESATSIEVNIDVLIREV 211 TSHT KNPNRKFWK C +F+W E ID+L+ EV Sbjct: 26 TSHTTKNPNRKFWKCRVCKNFQWAEDRKFSNEKIDLLVEEV 66