BLASTX nr result
ID: Phellodendron21_contig00018980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018980 (521 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO52284.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] 94 2e-19 KDO52277.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] 94 3e-19 KDO52279.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] 94 3e-19 KDO52278.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] 94 3e-19 KDO52280.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] 94 4e-19 KDO52276.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] 94 4e-19 KDO52275.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] 94 4e-19 XP_006427462.1 hypothetical protein CICLE_v10025249mg [Citrus cl... 94 4e-19 XP_006492112.1 PREDICTED: F-box/LRR-repeat protein 2 [Citrus sin... 94 4e-19 XP_006427460.1 hypothetical protein CICLE_v10025249mg [Citrus cl... 94 4e-19 EOY25936.1 Leucine-rich repeat family protein isoform 1 [Theobro... 93 6e-19 XP_017978971.1 PREDICTED: F-box/LRR-repeat protein 13 [Theobroma... 93 6e-19 OMO54448.1 Leucine-rich repeat, cysteine-containing subtype [Cor... 93 8e-19 OMP01452.1 Leucine-rich repeat, cysteine-containing subtype [Cor... 93 8e-19 KHG20419.1 Leucine-rich repeat-containing 18 [Gossypium arboreum] 88 4e-18 XP_011073379.1 PREDICTED: F-box/LRR-repeat protein 14 [Sesamum i... 91 5e-18 OAY36931.1 hypothetical protein MANES_11G061100 [Manihot esculen... 90 9e-18 GAV85786.1 LRR_4 domain-containing protein/LRR_6 domain-containi... 89 2e-17 EEF44864.1 F-box/LRR-repeat protein, putative [Ricinus communis] 88 3e-17 XP_019159950.1 PREDICTED: uncharacterized protein LOC109156560 [... 88 3e-17 >KDO52284.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] Length = 406 Score = 93.6 bits (231), Expect = 2e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 358 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 406 >KDO52277.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] Length = 472 Score = 93.6 bits (231), Expect = 3e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 424 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 472 >KDO52279.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] Length = 479 Score = 93.6 bits (231), Expect = 3e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 431 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 479 >KDO52278.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] Length = 479 Score = 93.6 bits (231), Expect = 3e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 431 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 479 >KDO52280.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] Length = 497 Score = 93.6 bits (231), Expect = 4e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 449 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 497 >KDO52276.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] Length = 503 Score = 93.6 bits (231), Expect = 4e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 455 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 503 >KDO52275.1 hypothetical protein CISIN_1g009672mg [Citrus sinensis] Length = 529 Score = 93.6 bits (231), Expect = 4e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 481 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 529 >XP_006427462.1 hypothetical protein CICLE_v10025249mg [Citrus clementina] ESR40702.1 hypothetical protein CICLE_v10025249mg [Citrus clementina] Length = 529 Score = 93.6 bits (231), Expect = 4e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 481 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 529 >XP_006492112.1 PREDICTED: F-box/LRR-repeat protein 2 [Citrus sinensis] XP_006492113.1 PREDICTED: F-box/LRR-repeat protein 2 [Citrus sinensis] XP_006492114.1 PREDICTED: F-box/LRR-repeat protein 2 [Citrus sinensis] XP_006492115.1 PREDICTED: F-box/LRR-repeat protein 2 [Citrus sinensis] Length = 578 Score = 93.6 bits (231), Expect = 4e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 530 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 578 >XP_006427460.1 hypothetical protein CICLE_v10025249mg [Citrus clementina] XP_006427461.1 hypothetical protein CICLE_v10025249mg [Citrus clementina] ESR40700.1 hypothetical protein CICLE_v10025249mg [Citrus clementina] ESR40701.1 hypothetical protein CICLE_v10025249mg [Citrus clementina] Length = 578 Score = 93.6 bits (231), Expect = 4e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIK+LQS D PNLVSFRPE Sbjct: 530 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKRLQSRDLPNLVSFRPE 578 >EOY25936.1 Leucine-rich repeat family protein isoform 1 [Theobroma cacao] Length = 574 Score = 93.2 bits (230), Expect = 6e-19 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDI+KLQS+D PNLV+FRPE Sbjct: 526 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIRKLQSADLPNLVNFRPE 574 >XP_017978971.1 PREDICTED: F-box/LRR-repeat protein 13 [Theobroma cacao] Length = 578 Score = 93.2 bits (230), Expect = 6e-19 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDI+KLQS+D PNLV+FRPE Sbjct: 530 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIRKLQSADLPNLVNFRPE 578 >OMO54448.1 Leucine-rich repeat, cysteine-containing subtype [Corchorus capsularis] Length = 579 Score = 92.8 bits (229), Expect = 8e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSS PNLV+FRPE Sbjct: 531 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSHLPNLVNFRPE 579 >OMP01452.1 Leucine-rich repeat, cysteine-containing subtype [Corchorus olitorius] Length = 644 Score = 92.8 bits (229), Expect = 8e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSS PNLV+FRPE Sbjct: 596 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSHLPNLVNFRPE 644 >KHG20419.1 Leucine-rich repeat-containing 18 [Gossypium arboreum] Length = 240 Score = 87.8 bits (216), Expect = 4e-18 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SR+TSAGLRHLKPLKNLRSLTLE+CKVTANDI++LQS+ PNLV+FRPE Sbjct: 192 SRVTSAGLRHLKPLKNLRSLTLEACKVTANDIRRLQSAGLPNLVNFRPE 240 >XP_011073379.1 PREDICTED: F-box/LRR-repeat protein 14 [Sesamum indicum] Length = 578 Score = 90.5 bits (223), Expect = 5e-18 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SR+TSAGL+HLK LKNL+SLTLESCKVTANDIKKLQSSD PNLVSFRPE Sbjct: 530 SRVTSAGLQHLKSLKNLKSLTLESCKVTANDIKKLQSSDLPNLVSFRPE 578 >OAY36931.1 hypothetical protein MANES_11G061100 [Manihot esculenta] OAY36932.1 hypothetical protein MANES_11G061100 [Manihot esculenta] OAY36933.1 hypothetical protein MANES_11G061100 [Manihot esculenta] Length = 578 Score = 89.7 bits (221), Expect = 9e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGL+HLKPLKNL+SLTLESCKVTANDIK+LQS+D P LVSFRPE Sbjct: 530 SRITSAGLKHLKPLKNLKSLTLESCKVTANDIKRLQSTDLPQLVSFRPE 578 >GAV85786.1 LRR_4 domain-containing protein/LRR_6 domain-containing protein [Cephalotus follicularis] Length = 578 Score = 88.6 bits (218), Expect = 2e-17 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGL+HLKPLKNLRSLTLESCKV+A+DI+KLQ++D PNLVSFRPE Sbjct: 530 SRITSAGLKHLKPLKNLRSLTLESCKVSADDIRKLQAADLPNLVSFRPE 578 >EEF44864.1 F-box/LRR-repeat protein, putative [Ricinus communis] Length = 529 Score = 88.2 bits (217), Expect = 3e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGL+HLKPLKNL+SLTLESCKVTA DIKKLQS+D P LVSFRPE Sbjct: 481 SRITSAGLQHLKPLKNLKSLTLESCKVTATDIKKLQSTDLPQLVSFRPE 529 >XP_019159950.1 PREDICTED: uncharacterized protein LOC109156560 [Ipomoea nil] XP_019159951.1 PREDICTED: uncharacterized protein LOC109156560 [Ipomoea nil] XP_019159952.1 PREDICTED: uncharacterized protein LOC109156560 [Ipomoea nil] Length = 578 Score = 88.2 bits (217), Expect = 3e-17 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = -1 Query: 521 SRITSAGLRHLKPLKNLRSLTLESCKVTANDIKKLQSSDFPNLVSFRPE 375 SRITSAGL+HLKPLK L+SLTLESCKVTANDIKKLQS+D PNLV++RPE Sbjct: 530 SRITSAGLQHLKPLKKLKSLTLESCKVTANDIKKLQSTDLPNLVNYRPE 578