BLASTX nr result
ID: Phellodendron21_contig00018883
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018883 (656 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019428313.1 PREDICTED: transportin-1-like [Lupinus angustifol... 60 4e-07 XP_015969946.1 PREDICTED: transportin-1-like [Arachis duranensis... 57 2e-06 CAN68295.1 hypothetical protein VITISV_033561 [Vitis vinifera] 58 2e-06 XP_019074488.1 PREDICTED: transportin-1 isoform X2 [Vitis vinifera] 58 2e-06 XP_010646592.1 PREDICTED: transportin-1 isoform X1 [Vitis vinifera] 58 2e-06 CBI37828.3 unnamed protein product, partial [Vitis vinifera] 58 2e-06 KNA13109.1 hypothetical protein SOVF_119770 [Spinacia oleracea] 58 3e-06 XP_014513536.1 PREDICTED: transportin-1 isoform X2 [Vigna radiat... 57 4e-06 KOM36413.1 hypothetical protein LR48_Vigan02g256300 [Vigna angul... 57 4e-06 KHN11503.1 Transportin-1 [Glycine soja] 57 4e-06 XP_010688095.1 PREDICTED: transportin-1 [Beta vulgaris subsp. vu... 57 4e-06 KHN37386.1 Transportin-1 [Glycine soja] 57 4e-06 XP_003536725.1 PREDICTED: transportin-1-like [Glycine max] KRH36... 57 4e-06 XP_017414546.1 PREDICTED: transportin-1 [Vigna angularis] BAT936... 57 4e-06 XP_014513535.1 PREDICTED: transportin-1 isoform X1 [Vigna radiat... 57 4e-06 XP_003555856.1 PREDICTED: transportin-1-like isoform X1 [Glycine... 57 4e-06 XP_007142798.1 hypothetical protein PHAVU_007G017800g [Phaseolus... 57 4e-06 KZV42117.1 Importin beta-2 isoform 2 [Dorcoceras hygrometricum] 57 4e-06 CAD56216.1 transportin-like protein, partial [Cicer arietinum] 57 5e-06 XP_015941924.1 PREDICTED: transportin-1 isoform X2 [Arachis dura... 57 6e-06 >XP_019428313.1 PREDICTED: transportin-1-like [Lupinus angustifolius] OIV91269.1 hypothetical protein TanjilG_30491 [Lupinus angustifolius] Length = 891 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQMLG+G W+QC+SALEPPV+ KLS YQV Sbjct: 858 VLNGYKQMLGNGAWDQCMSALEPPVKEKLSKYQV 891 >XP_015969946.1 PREDICTED: transportin-1-like [Arachis duranensis] XP_015969947.1 PREDICTED: transportin-1-like [Arachis duranensis] XP_015969948.1 PREDICTED: transportin-1-like [Arachis duranensis] Length = 197 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPP++ KLS YQV Sbjct: 164 VLHGYKQMLRNGAWDQCMSALEPPIKEKLSKYQV 197 >CAN68295.1 hypothetical protein VITISV_033561 [Vitis vinifera] Length = 528 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G WEQC+SALEPPV+ KLS YQV Sbjct: 495 VLHGYKQMLRNGAWEQCMSALEPPVKDKLSKYQV 528 >XP_019074488.1 PREDICTED: transportin-1 isoform X2 [Vitis vinifera] Length = 807 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G WEQC+SALEPPV+ KLS YQV Sbjct: 774 VLHGYKQMLRNGAWEQCMSALEPPVKDKLSKYQV 807 >XP_010646592.1 PREDICTED: transportin-1 isoform X1 [Vitis vinifera] Length = 890 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G WEQC+SALEPPV+ KLS YQV Sbjct: 857 VLHGYKQMLRNGAWEQCMSALEPPVKDKLSKYQV 890 >CBI37828.3 unnamed protein product, partial [Vitis vinifera] Length = 896 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G WEQC+SALEPPV+ KLS YQV Sbjct: 857 VLHGYKQMLRNGAWEQCMSALEPPVKDKLSKYQV 890 >KNA13109.1 hypothetical protein SOVF_119770 [Spinacia oleracea] Length = 894 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQMLG+G+WEQC+S+LEPP++ KL YQ+ Sbjct: 861 VLHGYKQMLGNGQWEQCISSLEPPMKEKLLKYQI 894 >XP_014513536.1 PREDICTED: transportin-1 isoform X2 [Vigna radiata var. radiata] Length = 861 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 828 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 861 >KOM36413.1 hypothetical protein LR48_Vigan02g256300 [Vigna angularis] Length = 861 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 828 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 861 >KHN11503.1 Transportin-1 [Glycine soja] Length = 891 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 858 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 891 >XP_010688095.1 PREDICTED: transportin-1 [Beta vulgaris subsp. vulgaris] KMT02959.1 hypothetical protein BVRB_8g195290 [Beta vulgaris subsp. vulgaris] Length = 892 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQMLG+G+WEQC+S+LEP V+ KLS YQ+ Sbjct: 859 VLHGYKQMLGNGQWEQCVSSLEPAVKDKLSKYQI 892 >KHN37386.1 Transportin-1 [Glycine soja] Length = 893 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 860 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 893 >XP_003536725.1 PREDICTED: transportin-1-like [Glycine max] KRH36099.1 hypothetical protein GLYMA_10G283400 [Glycine max] Length = 893 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 860 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 893 >XP_017414546.1 PREDICTED: transportin-1 [Vigna angularis] BAT93674.1 hypothetical protein VIGAN_08019800 [Vigna angularis var. angularis] Length = 894 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 861 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 894 >XP_014513535.1 PREDICTED: transportin-1 isoform X1 [Vigna radiata var. radiata] Length = 894 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 861 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 894 >XP_003555856.1 PREDICTED: transportin-1-like isoform X1 [Glycine max] KRG90653.1 hypothetical protein GLYMA_20G106300 [Glycine max] Length = 896 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 863 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 896 >XP_007142798.1 hypothetical protein PHAVU_007G017800g [Phaseolus vulgaris] ESW14792.1 hypothetical protein PHAVU_007G017800g [Phaseolus vulgaris] Length = 897 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPPV+ KLS YQV Sbjct: 864 VLHGYKQMLRNGAWDQCMSALEPPVKEKLSKYQV 897 >KZV42117.1 Importin beta-2 isoform 2 [Dorcoceras hygrometricum] Length = 901 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML DG W+QC+SALEPPV+ +LS YQV Sbjct: 863 VLYGYKQMLKDGAWDQCMSALEPPVKQRLSKYQV 896 >CAD56216.1 transportin-like protein, partial [Cicer arietinum] Length = 427 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPP++ KLS YQV Sbjct: 394 VLHGYKQMLRNGAWDQCMSALEPPIKEKLSKYQV 427 >XP_015941924.1 PREDICTED: transportin-1 isoform X2 [Arachis duranensis] Length = 735 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 655 VLRGYKQMLGDGEWEQCLSALEPPVRAKLSTYQV 554 VL GYKQML +G W+QC+SALEPP++ KLS YQV Sbjct: 702 VLHGYKQMLRNGAWDQCMSALEPPIKEKLSKYQV 735