BLASTX nr result
ID: Phellodendron21_contig00018710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018710 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007404440.1 hypothetical protein MELLADRAFT_115131 [Melampsor... 75 5e-13 >XP_007404440.1 hypothetical protein MELLADRAFT_115131 [Melampsora larici-populina 98AG31] EGG12065.1 hypothetical protein MELLADRAFT_115131 [Melampsora larici-populina 98AG31] Length = 809 Score = 75.1 bits (183), Expect = 5e-13 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +3 Query: 3 GEHDGEHTCGDLASLYKKAREKLSHLHQQHKVKISKELRNELREALHN 146 GEHDGEHTCGDLASLYK+A+EKL LH+ KVKI LR+ELR+ LH+ Sbjct: 761 GEHDGEHTCGDLASLYKQAKEKLGPLHKHKKVKIPASLRHELRQQLHS 808