BLASTX nr result
ID: Phellodendron21_contig00018489
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018489 (830 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414323.1 hypothetical protein MELLADRAFT_91428 [Melampsora... 68 4e-09 >XP_007414323.1 hypothetical protein MELLADRAFT_91428 [Melampsora larici-populina 98AG31] EGG02338.1 hypothetical protein MELLADRAFT_91428 [Melampsora larici-populina 98AG31] Length = 929 Score = 67.8 bits (164), Expect = 4e-09 Identities = 36/67 (53%), Positives = 45/67 (67%) Frame = +1 Query: 628 PTLGEVASHSESYCSHNPHTRLDSIHLSSEASGSWEQPLIANAADFFIHPFVESGEGAAE 807 P E S ++ + + HTRLDSIHLSS+ASG E + + AADF H F++SGEGA E Sbjct: 38 PASSEEHHDSTTHHASDRHTRLDSIHLSSDASG--ETSMASLAADFSTHSFIDSGEGATE 95 Query: 808 LRNARNP 828 LRNA NP Sbjct: 96 LRNAHNP 102