BLASTX nr result
ID: Phellodendron21_contig00018389
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018389 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006439906.1 hypothetical protein CICLE_v10019394mg [Citrus cl... 60 6e-08 XP_006476870.1 PREDICTED: DEAD-box ATP-dependent RNA helicase 20... 60 6e-08 XP_006439909.1 hypothetical protein CICLE_v10019394mg [Citrus cl... 60 6e-08 >XP_006439906.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] XP_006439907.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] XP_006439908.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] ESR53146.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] ESR53147.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] ESR53148.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] Length = 493 Score = 59.7 bits (143), Expect = 6e-08 Identities = 34/70 (48%), Positives = 37/70 (52%) Frame = -3 Query: 212 MSRYDHRYTDPDSYRLRRSDLIGLPSQIXXXXXXXXXXXXXXXXXXXXXXXXXGLAASSG 33 M+RYDHRY DPDSYR RRSDL+G P I GL A+ G Sbjct: 1 MNRYDHRYADPDSYRQRRSDLVGPPPPI---MGPGGPAPYGGPPPPPASYPGRGLGAAPG 57 Query: 32 AYPAVGRFDG 3 AYP VGRFDG Sbjct: 58 AYPPVGRFDG 67 >XP_006476870.1 PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Citrus sinensis] Length = 599 Score = 59.7 bits (143), Expect = 6e-08 Identities = 34/70 (48%), Positives = 37/70 (52%) Frame = -3 Query: 212 MSRYDHRYTDPDSYRLRRSDLIGLPSQIXXXXXXXXXXXXXXXXXXXXXXXXXGLAASSG 33 M+RYDHRY DPDSYR RRSDL+G P I GL A+ G Sbjct: 1 MNRYDHRYADPDSYRQRRSDLVGPPPPI---MGRGGPAPYGGPPPPPASYPGRGLGAAPG 57 Query: 32 AYPAVGRFDG 3 AYP VGRFDG Sbjct: 58 AYPPVGRFDG 67 >XP_006439909.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] ESR53149.1 hypothetical protein CICLE_v10019394mg [Citrus clementina] Length = 599 Score = 59.7 bits (143), Expect = 6e-08 Identities = 34/70 (48%), Positives = 37/70 (52%) Frame = -3 Query: 212 MSRYDHRYTDPDSYRLRRSDLIGLPSQIXXXXXXXXXXXXXXXXXXXXXXXXXGLAASSG 33 M+RYDHRY DPDSYR RRSDL+G P I GL A+ G Sbjct: 1 MNRYDHRYADPDSYRQRRSDLVGPPPPI---MGPGGPAPYGGPPPPPASYPGRGLGAAPG 57 Query: 32 AYPAVGRFDG 3 AYP VGRFDG Sbjct: 58 AYPPVGRFDG 67