BLASTX nr result
ID: Phellodendron21_contig00018228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018228 (781 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMS62068.1 DNA-directed RNA polymerase subunit alpha [Triticum u... 45 4e-08 >EMS62068.1 DNA-directed RNA polymerase subunit alpha [Triticum urartu] Length = 430 Score = 44.7 bits (104), Expect(2) = 4e-08 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -1 Query: 736 IHPPKEPDMIIFHHPARARINQ 671 IHPPKEPDM I+HHPARAR+ + Sbjct: 339 IHPPKEPDMRIYHHPARARVKE 360 Score = 41.2 bits (95), Expect(2) = 4e-08 Identities = 24/42 (57%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 581 RFYFTKL--QLSIARNSVLTGPCSIPK*AYKIHHDQELSGSS 462 RF F KL QL I N +L G CSI K AYK HDQ L G S Sbjct: 386 RFSFPKLHLQLLIENNPILMGKCSISKWAYKFDHDQLLCGLS 427