BLASTX nr result
ID: Phellodendron21_contig00018140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018140 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006452325.1 hypothetical protein CICLE_v10008983mg [Citrus cl... 75 5e-14 >XP_006452325.1 hypothetical protein CICLE_v10008983mg [Citrus clementina] XP_006452326.1 hypothetical protein CICLE_v10008983mg [Citrus clementina] XP_006475180.1 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase [Citrus sinensis] ESR65565.1 hypothetical protein CICLE_v10008983mg [Citrus clementina] ESR65566.1 hypothetical protein CICLE_v10008983mg [Citrus clementina] KDO62651.1 hypothetical protein CISIN_1g021485mg [Citrus sinensis] KDO62652.1 hypothetical protein CISIN_1g021485mg [Citrus sinensis] KDO62653.1 hypothetical protein CISIN_1g021485mg [Citrus sinensis] Length = 312 Score = 75.1 bits (183), Expect = 5e-14 Identities = 36/41 (87%), Positives = 39/41 (95%), Gaps = 1/41 (2%) Frame = +2 Query: 164 ASFLRNRRFESFLDTSCE-PNVKKPPRVSLKQEVGFRPKAE 283 ASF+RNRRFESFLDTSCE PNVK+PPRVS+KQE GFRPKAE Sbjct: 7 ASFMRNRRFESFLDTSCEQPNVKEPPRVSVKQEAGFRPKAE 47