BLASTX nr result
ID: Phellodendron21_contig00018004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00018004 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018838335.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 84 4e-18 XP_007017959.2 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 84 2e-17 EOY15184.1 Repressor of lrx1 [Theobroma cacao] 84 2e-17 XP_006435296.1 hypothetical protein CICLE_v10001644mg [Citrus cl... 84 2e-17 KDO85020.1 hypothetical protein CISIN_1g041164mg [Citrus sinensis] 84 2e-17 XP_018838334.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 84 2e-17 OMO85454.1 tRNA(Ile)-lysidine/2-thiocytidine synthase [Corchorus... 84 2e-17 XP_017981372.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 84 2e-17 XP_008221174.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 84 4e-17 ONI32262.1 hypothetical protein PRUPE_1G356900 [Prunus persica] 81 3e-16 XP_007222158.1 hypothetical protein PRUPE_ppa007715mg [Prunus pe... 81 3e-16 EYU36819.1 hypothetical protein MIMGU_mgv1a009088mg [Erythranthe... 80 1e-15 XP_012839213.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 80 1e-15 XP_008377106.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 79 2e-15 XP_012073692.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 79 3e-15 OAY44348.1 hypothetical protein MANES_08G142100 [Manihot esculenta] 78 4e-15 XP_008387886.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 78 4e-15 XP_011074728.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 77 8e-15 XP_009334379.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 77 1e-14 XP_015893480.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein ... 76 3e-14 >XP_018838335.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 isoform X2 [Juglans regia] Length = 219 Score = 84.3 bits (207), Expect = 4e-18 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG N DRKK +K+N GTKSIESKQCGTLDF Sbjct: 172 VLLEGLNRGLPKLGIGRSRGLNDDRKKGIKENIGTKSIESKQCGTLDF 219 >XP_007017959.2 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 isoform X1 [Theobroma cacao] Length = 355 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG N D KKD KQ GGTKSIESKQCG+LDF Sbjct: 308 VLLEGLNRGLPKLGIGRSRGLNNDIKKDTKQGGGTKSIESKQCGSLDF 355 >EOY15184.1 Repressor of lrx1 [Theobroma cacao] Length = 355 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG N D KKD KQ GGTKSIESKQCG+LDF Sbjct: 308 VLLEGLNRGLPKLGIGRSRGLNNDIKKDTKQGGGTKSIESKQCGSLDF 355 >XP_006435296.1 hypothetical protein CICLE_v10001644mg [Citrus clementina] XP_006473748.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Citrus sinensis] ESR48536.1 hypothetical protein CICLE_v10001644mg [Citrus clementina] Length = 356 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPKMGI RSRG N +R KDMKQN GTK+IESKQCGTLDF Sbjct: 309 VLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF 356 >KDO85020.1 hypothetical protein CISIN_1g041164mg [Citrus sinensis] Length = 357 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPKMGI RSRG N +R KDMKQN GTK+IESKQCGTLDF Sbjct: 310 VLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF 357 >XP_018838334.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 isoform X1 [Juglans regia] Length = 358 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG N DRKK +K+N GTKSIESKQCGTLDF Sbjct: 311 VLLEGLNRGLPKLGIGRSRGLNDDRKKGIKENIGTKSIESKQCGTLDF 358 >OMO85454.1 tRNA(Ile)-lysidine/2-thiocytidine synthase [Corchorus olitorius] Length = 328 Score = 84.0 bits (206), Expect = 2e-17 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG N D KKD+KQ+ GTKSIESKQCG+LDF Sbjct: 281 VLLEGLNRGLPKLGIGRSRGLNSDVKKDVKQDSGTKSIESKQCGSLDF 328 >XP_017981372.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 isoform X2 [Theobroma cacao] Length = 368 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG N D KKD KQ GGTKSIESKQCG+LDF Sbjct: 321 VLLEGLNRGLPKLGIGRSRGLNNDIKKDTKQGGGTKSIESKQCGSLDF 368 >XP_008221174.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Prunus mume] Length = 357 Score = 83.6 bits (205), Expect = 4e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGR+RG N D KKD K+N GTKSIESKQCGTLDF Sbjct: 310 VLLEGLNRGLPKLGIGRTRGLNNDDKKDTKKNNGTKSIESKQCGTLDF 357 >ONI32262.1 hypothetical protein PRUPE_1G356900 [Prunus persica] Length = 357 Score = 81.3 bits (199), Expect = 3e-16 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGR+RG N D KKD K+ GTKSIESKQCGTLDF Sbjct: 310 VLLEGLNRGLPKLGIGRTRGLNNDDKKDTKKTNGTKSIESKQCGTLDF 357 >XP_007222158.1 hypothetical protein PRUPE_ppa007715mg [Prunus persica] Length = 358 Score = 81.3 bits (199), Expect = 3e-16 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGR+RG N D KKD K+ GTKSIESKQCGTLDF Sbjct: 311 VLLEGLNRGLPKLGIGRTRGLNNDDKKDTKKTNGTKSIESKQCGTLDF 358 >EYU36819.1 hypothetical protein MIMGU_mgv1a009088mg [Erythranthe guttata] Length = 353 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPKMGIGRSRG + +R KD+K+ GTKS+ESKQCG+LDF Sbjct: 306 VLLEGLNRGLPKMGIGRSRGIDNERNKDVKETNGTKSLESKQCGSLDF 353 >XP_012839213.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Erythranthe guttata] Length = 358 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPKMGIGRSRG + +R KD+K+ GTKS+ESKQCG+LDF Sbjct: 311 VLLEGLNRGLPKMGIGRSRGIDNERNKDVKETNGTKSLESKQCGSLDF 358 >XP_008377106.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Malus domestica] Length = 357 Score = 79.0 bits (193), Expect = 2e-15 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLN+GLPK+GIGR+RG N D KKD K+ GTKSIESKQCG+LDF Sbjct: 310 VLLEGLNKGLPKLGIGRTRGLNNDDKKDAKERNGTKSIESKQCGSLDF 357 >XP_012073692.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Jatropha curcas] KDP36846.1 hypothetical protein JCGZ_08137 [Jatropha curcas] Length = 356 Score = 78.6 bits (192), Expect = 3e-15 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRS+G + D +KD+K N GTK+IESKQCGTLDF Sbjct: 309 VLLEGLNRGLPKLGIGRSQGIDNDGRKDVKDNHGTKNIESKQCGTLDF 356 >OAY44348.1 hypothetical protein MANES_08G142100 [Manihot esculenta] Length = 357 Score = 78.2 bits (191), Expect = 4e-15 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG + D +KD+K + GTK+IESKQCGTLDF Sbjct: 310 VLLEGLNRGLPKLGIGRSRGLDNDGRKDVKHSTGTKNIESKQCGTLDF 357 >XP_008387886.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Malus domestica] Length = 357 Score = 78.2 bits (191), Expect = 4e-15 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLN+GLPK+GIGRSRG N D K D K+ GTKSIESKQCG+LDF Sbjct: 310 VLLEGLNKGLPKLGIGRSRGLNNDGKNDTKERNGTKSIESKQCGSLDF 357 >XP_011074728.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Sesamum indicum] Length = 359 Score = 77.4 bits (189), Expect = 8e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGR+RG N + KDMK+ GTK ++SKQCGTLDF Sbjct: 312 VLLEGLNRGLPKLGIGRTRGLNNESNKDMKETNGTKGLQSKQCGTLDF 359 >XP_009334379.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Pyrus x bretschneideri] Length = 357 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLN+GLPK+GIGRSRG N D K D K+ GTKSIESKQCG+LD+ Sbjct: 310 VLLEGLNKGLPKLGIGRSRGLNNDGKNDTKERNGTKSIESKQCGSLDY 357 >XP_015893480.1 PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Ziziphus jujuba] Length = 357 Score = 75.9 bits (185), Expect = 3e-14 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +3 Query: 3 VLLEGLNRGLPKMGIGRSRGHNCDRKKDMKQNGGTKSIESKQCGTLDF 146 VLLEGLNRGLPK+GIGRSRG N + KD+K+ G +SIESKQCG+LDF Sbjct: 310 VLLEGLNRGLPKLGIGRSRGLNQENSKDVKKGNGARSIESKQCGSLDF 357