BLASTX nr result
ID: Phellodendron21_contig00017977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00017977 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003851852.1 60S ribosomal protein L27 [Zymoseptoria tritici I... 125 4e-35 XP_016761147.1 Ribosomal_L27e-domain-containing protein [Sphaeru... 123 4e-34 KXL44732.1 hypothetical protein FE78DRAFT_99967 [Acidomyces rich... 122 1e-33 XP_007928011.1 hypothetical protein MYCFIDRAFT_55940 [Pseudocerc... 122 1e-33 EME42700.1 hypothetical protein DOTSEDRAFT_90017 [Dothistroma se... 122 1e-33 KXS95494.1 hypothetical protein AC578_8803 [Mycosphaerella eumusae] 123 2e-33 GAM86657.1 hypothetical protein ANO11243_046730 [fungal sp. No.1... 119 2e-32 EKG17758.1 Ribosomal protein L27e [Macrophomina phaseolina MS6] 118 3e-32 XP_003068700.1 60S ribosomal protein L27 [Coccidioides posadasii... 118 5e-32 XP_013324354.1 60S ribosomal protein L27 [Rasamsonia emersonii C... 117 6e-32 EZF11226.1 hypothetical protein H100_07669 [Trichophyton rubrum ... 117 9e-32 EZF11225.1 hypothetical protein H100_07669 [Trichophyton rubrum ... 117 1e-31 EGE00457.1 60S ribosomal protein L27-A [Trichophyton tonsurans C... 117 1e-31 XP_003177187.1 60S ribosomal protein L27-A [Nannizzia gypsea CBS... 117 1e-31 XP_002850593.1 60S ribosomal protein L27 [Arthroderma otae CBS 1... 117 1e-31 XP_020128848.1 60s ribosomal protein l27 [Diplodia corticola] OJ... 117 1e-31 KKY24219.1 putative 60s ribosomal protein l27 [Diplodia seriata] 117 1e-31 KFX49293.1 60S ribosomal protein L27-B [Talaromyces marneffei PM1] 116 2e-31 KUL92043.1 hypothetical protein ZTR_01132 [Talaromyces verruculo... 116 2e-31 XP_002143603.1 60S ribosomal protein L27 [Talaromyces marneffei ... 116 2e-31 >XP_003851852.1 60S ribosomal protein L27 [Zymoseptoria tritici IPO323] EGP86828.1 hypothetical protein MYCGRDRAFT_59963 [Zymoseptoria tritici IPO323] KJX92863.1 60s ribosomal protein l27 [Zymoseptoria brevis] Length = 135 Score = 125 bits (315), Expect = 4e-35 Identities = 60/60 (100%), Positives = 60/60 (100%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 135 >XP_016761147.1 Ribosomal_L27e-domain-containing protein [Sphaerulina musiva SO2202] EMF13026.1 Ribosomal_L27e-domain-containing protein [Sphaerulina musiva SO2202] Length = 135 Score = 123 bits (309), Expect = 4e-34 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYSSGKNRWFFTPLRF 135 >KXL44732.1 hypothetical protein FE78DRAFT_99967 [Acidomyces richmondensis] KYG45099.1 hypothetical protein M433DRAFT_166428 [Acidomyces richmondensis BFW] Length = 135 Score = 122 bits (306), Expect = 1e-33 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNH+MPTRYTLELEGLKGVVTNETFTEV+QREEAKKTVKKALEERY+SGKNRWFFTPLRF Sbjct: 76 YNHIMPTRYTLELEGLKGVVTNETFTEVSQREEAKKTVKKALEERYLSGKNRWFFTPLRF 135 >XP_007928011.1 hypothetical protein MYCFIDRAFT_55940 [Pseudocercospora fijiensis CIRAD86] EME80946.1 hypothetical protein MYCFIDRAFT_55940 [Pseudocercospora fijiensis CIRAD86] Length = 136 Score = 122 bits (305), Expect = 1e-33 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVVTNETFTEV+QREEAKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 77 YNHLMPTRYTLELEGLKGVVTNETFTEVSQREEAKKTVKKALEERYSSGKNRWFFTPLRF 136 >EME42700.1 hypothetical protein DOTSEDRAFT_90017 [Dothistroma septosporum NZE10] Length = 136 Score = 122 bits (305), Expect = 1e-33 Identities = 58/60 (96%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVVT ETFTEVTQREEAKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 77 YNHLMPTRYTLELEGLKGVVTTETFTEVTQREEAKKTVKKALEERYTSGKNRWFFTPLRF 136 >KXS95494.1 hypothetical protein AC578_8803 [Mycosphaerella eumusae] Length = 196 Score = 123 bits (309), Expect = 2e-33 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 137 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYSSGKNRWFFTPLRF 196 >GAM86657.1 hypothetical protein ANO11243_046730 [fungal sp. No.11243] Length = 135 Score = 119 bits (297), Expect = 2e-32 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNH+MPTRYTLELEGLKGVVTN+TF EV+QRE+AKKTVKKALEERYVSGKNRWFFTPLRF Sbjct: 76 YNHIMPTRYTLELEGLKGVVTNDTFKEVSQREDAKKTVKKALEERYVSGKNRWFFTPLRF 135 >EKG17758.1 Ribosomal protein L27e [Macrophomina phaseolina MS6] Length = 135 Score = 118 bits (296), Expect = 3e-32 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVVTN+TF EV+QREEAKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVTNDTFKEVSQREEAKKTVKKALEERYQSGKNRWFFTPLRF 135 >XP_003068700.1 60S ribosomal protein L27 [Coccidioides posadasii C735 delta SOWgp] XP_012213676.1 60S ribosomal protein L27-B [Coccidioides immitis RS] EER26555.1 60S ribosomal protein L27-B, putative [Coccidioides posadasii C735 delta SOWgp] EFW20596.1 60S ribosomal protein L27e [Coccidioides posadasii str. Silveira] KJF61510.1 60S ribosomal protein L27-B [Coccidioides immitis RS] KMM72841.1 60S ribosomal protein L27-B [Coccidioides posadasii RMSCC 3488] KMP07731.1 60S ribosomal protein L27-B [Coccidioides immitis RMSCC 2394] KMU71814.1 60S ribosomal protein L27-B [Coccidioides immitis RMSCC 3703] KMU82819.1 60S ribosomal protein L27-B [Coccidioides immitis H538.4] Length = 135 Score = 118 bits (295), Expect = 5e-32 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVVTN+TF EV+QREEAKKTVKKALE+RY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVTNDTFKEVSQREEAKKTVKKALEDRYTSGKNRWFFTPLRF 135 >XP_013324354.1 60S ribosomal protein L27 [Rasamsonia emersonii CBS 393.64] KKA17742.1 60S ribosomal protein L27 [Rasamsonia emersonii CBS 393.64] Length = 132 Score = 117 bits (294), Expect = 6e-32 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGV+TN+TF EV+QREEAKKT+KKALEERY SGKNRWFFTPLRF Sbjct: 73 YNHLMPTRYTLELEGLKGVLTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF 132 >EZF11226.1 hypothetical protein H100_07669 [Trichophyton rubrum MR850] EZF38091.1 hypothetical protein H102_07634 [Trichophyton rubrum CBS 100081] EZF48730.1 hypothetical protein H103_07657 [Trichophyton rubrum CBS 288.86] EZF59428.1 hypothetical protein H104_07605 [Trichophyton rubrum CBS 289.86] EZF69968.1 hypothetical protein H105_07660 [Trichophyton soudanense CBS 452.61] EZF80662.1 hypothetical protein H110_07654 [Trichophyton rubrum MR1448] EZF91310.1 hypothetical protein H113_07715 [Trichophyton rubrum MR1459] EZG02247.1 hypothetical protein H106_07492 [Trichophyton rubrum CBS 735.88] EZG12891.1 hypothetical protein H107_07791 [Trichophyton rubrum CBS 202.88] KDB29827.1 hypothetical protein H112_07644 [Trichophyton rubrum D6] KFL60147.1 hypothetical protein TERG_00242 [Trichophyton rubrum CBS 118892] Length = 132 Score = 117 bits (293), Expect = 9e-32 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKG VTN+TF EV+QREEAKKT+KKALEERY SGKNRWFFTPLRF Sbjct: 73 YNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF 132 >EZF11225.1 hypothetical protein H100_07669 [Trichophyton rubrum MR850] EZF38090.1 hypothetical protein H102_07634 [Trichophyton rubrum CBS 100081] EZF48729.1 hypothetical protein H103_07657 [Trichophyton rubrum CBS 288.86] EZF59427.1 hypothetical protein H104_07605 [Trichophyton rubrum CBS 289.86] EZF69967.1 hypothetical protein H105_07660 [Trichophyton soudanense CBS 452.61] EZF80661.1 hypothetical protein H110_07654 [Trichophyton rubrum MR1448] EZF91309.1 hypothetical protein H113_07715 [Trichophyton rubrum MR1459] EZG02246.1 hypothetical protein H106_07492 [Trichophyton rubrum CBS 735.88] EZG12890.1 hypothetical protein H107_07791 [Trichophyton rubrum CBS 202.88] KDB29826.1 hypothetical protein H112_07644 [Trichophyton rubrum D6] KFL60146.1 hypothetical protein TERG_00242 [Trichophyton rubrum CBS 118892] OAL73831.1 hypothetical protein A7D00_1859 [Trichophyton violaceum] Length = 135 Score = 117 bits (293), Expect = 1e-31 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKG VTN+TF EV+QREEAKKT+KKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF 135 >EGE00457.1 60S ribosomal protein L27-A [Trichophyton tonsurans CBS 112818] EZF34255.1 hypothetical protein H101_02193 [Trichophyton interdigitale H6] KDB22715.1 hypothetical protein H109_05381 [Trichophyton interdigitale MR816] DAA78245.1 TPA_exp: Uncharacterized protein A8136_4221 [Trichophyton benhamiae CBS 112371] Length = 135 Score = 117 bits (293), Expect = 1e-31 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKG VTN+TF EV+QREEAKKT+KKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF 135 >XP_003177187.1 60S ribosomal protein L27-A [Nannizzia gypsea CBS 118893] EFQ98235.1 60S ribosomal protein L27-A [Nannizzia gypsea CBS 118893] Length = 135 Score = 117 bits (293), Expect = 1e-31 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKG VTN+TF EV+QREEAKKT+KKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF 135 >XP_002850593.1 60S ribosomal protein L27 [Arthroderma otae CBS 113480] EEQ27809.1 60S ribosomal protein L27-A [Arthroderma otae CBS 113480] Length = 135 Score = 117 bits (293), Expect = 1e-31 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKG VTN+TF EV+QREEAKKT+KKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLRF 135 >XP_020128848.1 60s ribosomal protein l27 [Diplodia corticola] OJD32588.1 60s ribosomal protein l27 [Diplodia corticola] Length = 135 Score = 117 bits (292), Expect = 1e-31 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVV+N+TF EV+QREEAKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVSNDTFKEVSQREEAKKTVKKALEERYQSGKNRWFFTPLRF 135 >KKY24219.1 putative 60s ribosomal protein l27 [Diplodia seriata] Length = 135 Score = 117 bits (292), Expect = 1e-31 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVV+N+TF EV+QREEAKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVSNDTFKEVSQREEAKKTVKKALEERYQSGKNRWFFTPLRF 135 >KFX49293.1 60S ribosomal protein L27-B [Talaromyces marneffei PM1] Length = 132 Score = 116 bits (291), Expect = 2e-31 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVV+N+TF EV+QRE+AKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 73 YNHLMPTRYTLELEGLKGVVSNDTFKEVSQREDAKKTVKKALEERYTSGKNRWFFTPLRF 132 >KUL92043.1 hypothetical protein ZTR_01132 [Talaromyces verruculosus] Length = 135 Score = 116 bits (291), Expect = 2e-31 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVV+N+TF EV+QRE+AKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVSNDTFKEVSQREDAKKTVKKALEERYTSGKNRWFFTPLRF 135 >XP_002143603.1 60S ribosomal protein L27 [Talaromyces marneffei ATCC 18224] EEA27088.1 60S ribosomal protein L27e [Talaromyces marneffei ATCC 18224] KFX49294.1 60S ribosomal protein L27-B [Talaromyces marneffei PM1] Length = 135 Score = 116 bits (291), Expect = 2e-31 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -3 Query: 321 YNHLMPTRYTLELEGLKGVVTNETFTEVTQREEAKKTVKKALEERYVSGKNRWFFTPLRF 142 YNHLMPTRYTLELEGLKGVV+N+TF EV+QRE+AKKTVKKALEERY SGKNRWFFTPLRF Sbjct: 76 YNHLMPTRYTLELEGLKGVVSNDTFKEVSQREDAKKTVKKALEERYTSGKNRWFFTPLRF 135