BLASTX nr result
ID: Phellodendron21_contig00017935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00017935 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007408900.1 gamma-tubulin complex [Melampsora larici-populina... 167 3e-46 KNE92200.1 hypothetical protein PSTG_14370 [Puccinia striiformis... 162 5e-44 XP_003330900.2 hypothetical protein PGTG_12437 [Puccinia gramini... 162 7e-44 KNZ45585.1 hypothetical protein VP01_7g25 [Puccinia sorghi] 162 7e-44 OAV86320.1 hypothetical protein PTTG_29967 [Puccinia triticina 1... 160 2e-43 OAV87031.1 hypothetical protein PTTG_08477 [Puccinia triticina 1... 155 9e-42 OAV96776.1 hypothetical protein PTTG_26250 [Puccinia triticina 1... 123 4e-33 KDQ10708.1 hypothetical protein BOTBODRAFT_36026 [Botryobasidium... 120 3e-29 OCF36769.1 gamma-tubulin complex component 2 [Kwoniella heveanen... 117 4e-28 KIR67339.1 gamma-tubulin complex component 2 [Cryptococcus gatti... 114 2e-27 KIR50360.1 gamma-tubulin complex component 2 [Cryptococcus gatti... 114 2e-27 XP_012046248.1 gamma-tubulin complex component 2 [Cryptococcus n... 115 2e-27 OCF40305.1 gamma-tubulin complex component 2 [Kwoniella heveanen... 115 2e-27 KIR87784.1 gamma-tubulin complex component 2 [Cryptococcus gatti... 114 2e-27 KIR55675.1 gamma-tubulin complex component 2 [Cryptococcus gatti... 114 2e-27 XP_003192154.1 gamma-tubulin complex component 2 (gcp-2) [Crypto... 114 2e-27 XP_007365679.1 hypothetical protein DICSQDRAFT_105728 [Dichomitu... 114 2e-27 XP_566695.1 gamma-tubulin complex component 2 (gcp-2) [Cryptococ... 114 2e-27 KIS01248.1 gamma-tubulin complex component 2 [Cryptococcus gatti... 114 2e-27 KIR40592.1 gamma-tubulin complex component 2 [Cryptococcus gatti... 114 2e-27 >XP_007408900.1 gamma-tubulin complex [Melampsora larici-populina 98AG31] EGG07568.1 gamma-tubulin complex [Melampsora larici-populina 98AG31] Length = 762 Score = 167 bits (424), Expect = 3e-46 Identities = 78/89 (87%), Positives = 86/89 (96%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 EG +VKGGEVLAVLEDRVM TLGDP+AS+LYSDLLLKASQPYC+MLIQWVT+G+L DPYE Sbjct: 186 EGMVVKGGEVLAVLEDRVMNTLGDPVASELYSDLLLKASQPYCKMLIQWVTQGILADPYE 245 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKYI 56 EFIIKESKSITRGTL+MDFTDEYWERKY+ Sbjct: 246 EFIIKESKSITRGTLDMDFTDEYWERKYV 274 >KNE92200.1 hypothetical protein PSTG_14370 [Puccinia striiformis f. sp. tritici PST-78] Length = 1177 Score = 162 bits (410), Expect = 5e-44 Identities = 74/89 (83%), Positives = 86/89 (96%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 EG++VKGGEVLA+LE+RVM++LGDPIA KLYSDLLLKASQPYC+MLIQWV +G+LDDPY+ Sbjct: 495 EGAMVKGGEVLAILEERVMRSLGDPIALKLYSDLLLKASQPYCKMLIQWVAKGILDDPYD 554 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKYI 56 EFIIKESKSITRGTL+ DFTDEYWERKY+ Sbjct: 555 EFIIKESKSITRGTLDEDFTDEYWERKYV 583 >XP_003330900.2 hypothetical protein PGTG_12437 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP86481.2 hypothetical protein PGTG_12437 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 1154 Score = 162 bits (409), Expect = 7e-44 Identities = 75/89 (84%), Positives = 85/89 (95%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 EG++VKGGEVLA+LE+RVM +LGDPIA KLYSDLLLKASQPYC+MLIQWV +G+LDDPYE Sbjct: 472 EGAMVKGGEVLAILEERVMGSLGDPIALKLYSDLLLKASQPYCKMLIQWVAKGILDDPYE 531 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKYI 56 EFIIKESKSITRGTL+ DFTDEYWERKY+ Sbjct: 532 EFIIKESKSITRGTLDEDFTDEYWERKYV 560 >KNZ45585.1 hypothetical protein VP01_7g25 [Puccinia sorghi] Length = 1305 Score = 162 bits (409), Expect = 7e-44 Identities = 74/89 (83%), Positives = 86/89 (96%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 EG++VKGGEVLA+LE+RVM++LGDPIA KLYSDLLLKASQPYC+MLIQWV +G+LDDPYE Sbjct: 522 EGAMVKGGEVLAILEERVMRSLGDPIALKLYSDLLLKASQPYCKMLIQWVAKGILDDPYE 581 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKYI 56 EFIIKESKSITRG+L+ DFTDEYWERKY+ Sbjct: 582 EFIIKESKSITRGSLDEDFTDEYWERKYV 610 >OAV86320.1 hypothetical protein PTTG_29967 [Puccinia triticina 1-1 BBBD Race 1] Length = 1137 Score = 160 bits (406), Expect = 2e-43 Identities = 74/89 (83%), Positives = 85/89 (95%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 EG++VKGGEVLA+LE+RVM +LGDPIA KLYSDLLLKASQPYC+MLIQWV +G+LDDPY+ Sbjct: 457 EGAMVKGGEVLAILEERVMGSLGDPIALKLYSDLLLKASQPYCKMLIQWVAKGILDDPYD 516 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKYI 56 EFIIKESKSITRGTL+ DFTDEYWERKY+ Sbjct: 517 EFIIKESKSITRGTLDEDFTDEYWERKYV 545 >OAV87031.1 hypothetical protein PTTG_08477 [Puccinia triticina 1-1 BBBD Race 1] Length = 875 Score = 155 bits (393), Expect = 9e-42 Identities = 72/89 (80%), Positives = 83/89 (93%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 EG++VKGGEVLA+LE+RVM + GDPIA KLYS LLLKASQPYC+MLIQWV +G+LDDPY+ Sbjct: 422 EGAMVKGGEVLAILEERVMGSSGDPIALKLYSGLLLKASQPYCKMLIQWVAKGILDDPYD 481 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKYI 56 EFIIKESKSITRGTL+ DFTDEYWERKY+ Sbjct: 482 EFIIKESKSITRGTLDEDFTDEYWERKYV 510 >OAV96776.1 hypothetical protein PTTG_26250 [Puccinia triticina 1-1 BBBD Race 1] Length = 195 Score = 123 bits (308), Expect = 4e-33 Identities = 60/83 (72%), Positives = 68/83 (81%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 EG +VKGGEVL +LE++VM LGDP A KLYSDLLLKASQ Y + LIQWV G+LDDPY Sbjct: 81 EGGMVKGGEVLVILEEQVMGLLGDPRALKLYSDLLLKASQSYYKRLIQWVANGILDDPYN 140 Query: 142 EFIIKESKSITRGTLEMDFTDEY 74 +FIIK S SITRGTL+ DFTDEY Sbjct: 141 DFIIKASNSITRGTLDDDFTDEY 163 >KDQ10708.1 hypothetical protein BOTBODRAFT_36026 [Botryobasidium botryosum FD-172 SS1] Length = 875 Score = 120 bits (300), Expect = 3e-29 Identities = 55/87 (63%), Positives = 69/87 (79%) Frame = -1 Query: 319 GSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYEE 140 G IVKGGEV+AVL +R+M T GDP A +LY LL AS+PY +ML +W+ G L DPY+E Sbjct: 319 GGIVKGGEVVAVLWERMMNTSGDPTAHQLYRKLLRDASRPYTQMLTRWIKMGHLSDPYDE 378 Query: 139 FIIKESKSITRGTLEMDFTDEYWERKY 59 F++KESK I RGTLEMD+TDEYW+R+Y Sbjct: 379 FMVKESKFINRGTLEMDYTDEYWDRRY 405 >OCF36769.1 gamma-tubulin complex component 2 [Kwoniella heveanensis BCC8398] Length = 946 Score = 117 bits (292), Expect = 4e-28 Identities = 52/87 (59%), Positives = 66/87 (75%) Frame = -1 Query: 319 GSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYEE 140 G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+ML+QW+T G L DP++E Sbjct: 397 GGPVLGGEVLGIISEREATMSGDPTASTLHSTLLLHASQPYCKMLVQWITTGYLADPFDE 456 Query: 139 FIIKESKSITRGTLEMDFTDEYWERKY 59 F++KES IT+G LE D+TDEYWER+Y Sbjct: 457 FLVKESGHITKGVLESDYTDEYWERRY 483 >KIR67339.1 gamma-tubulin complex component 2 [Cryptococcus gattii CA1873] Length = 567 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 361 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 420 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 421 EFMVKESGHITKGVLESDYTDEYWERRY 448 >KIR50360.1 gamma-tubulin complex component 2 [Cryptococcus gattii CA1280] Length = 567 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 361 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 420 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 421 EFMVKESGHITKGVLESDYTDEYWERRY 448 >XP_012046248.1 gamma-tubulin complex component 2 [Cryptococcus neoformans var. grubii H99] AFR92434.2 gamma-tubulin complex component 2 [Cryptococcus neoformans var. grubii H99] Length = 911 Score = 115 bits (287), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 365 DGGDVLGGEVLGIICEREANMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 424 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 425 EFMVKESGHITKGVLESDYTDEYWERRY 452 >OCF40305.1 gamma-tubulin complex component 2 [Kwoniella heveanensis CBS 569] Length = 912 Score = 115 bits (287), Expect = 2e-27 Identities = 52/87 (59%), Positives = 65/87 (74%) Frame = -1 Query: 319 GSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYEE 140 G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+ML+QW+T G L DP +E Sbjct: 363 GGPVLGGEVLGIISEREATMSGDPTASTLHSTLLLHASQPYCKMLVQWITTGYLADPCDE 422 Query: 139 FIIKESKSITRGTLEMDFTDEYWERKY 59 F++KES IT+G LE D+TDEYWER+Y Sbjct: 423 FLVKESGHITKGVLESDYTDEYWERRY 449 >KIR87784.1 gamma-tubulin complex component 2 [Cryptococcus gattii VGIV IND107] Length = 570 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 364 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 423 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 424 EFMVKESGHITKGVLESDYTDEYWERRY 451 >KIR55675.1 gamma-tubulin complex component 2 [Cryptococcus gattii Ru294] Length = 570 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 364 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 423 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 424 EFMVKESGHITKGVLESDYTDEYWERRY 451 >XP_003192154.1 gamma-tubulin complex component 2 (gcp-2) [Cryptococcus gattii WM276] ADV20367.1 Gamma-tubulin complex component 2 (gcp-2), putative [Cryptococcus gattii WM276] KIR77188.1 gamma-tubulin complex component 2 [Cryptococcus gattii EJB2] KIY36191.1 gamma-tubulin complex component 2 [Cryptococcus gattii E566] KJE06159.1 gamma-tubulin complex component 2 [Cryptococcus gattii NT-10] Length = 570 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 364 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 423 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 424 EFMVKESGHITKGVLESDYTDEYWERRY 451 >XP_007365679.1 hypothetical protein DICSQDRAFT_105728 [Dichomitus squalens LYAD-421 SS1] EJF61584.1 hypothetical protein DICSQDRAFT_105728 [Dichomitus squalens LYAD-421 SS1] Length = 867 Score = 114 bits (286), Expect = 2e-27 Identities = 52/87 (59%), Positives = 64/87 (73%) Frame = -1 Query: 319 GSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYEE 140 G VKGGEVLA+L +R+ GDP A +LY LL + +PY M+ W+T G LDDPYEE Sbjct: 306 GIAVKGGEVLAILHERMQNMSGDPAARELYGALLRDSGKPYVEMVQAWITTGKLDDPYEE 365 Query: 139 FIIKESKSITRGTLEMDFTDEYWERKY 59 ++KESK I RGTLEMD+TDEYWER+Y Sbjct: 366 LLVKESKFINRGTLEMDYTDEYWERRY 392 >XP_566695.1 gamma-tubulin complex component 2 (gcp-2) [Cryptococcus neoformans var. neoformans JEC21] AAW40876.1 gamma-tubulin complex component 2 (gcp-2), putative [Cryptococcus neoformans var. neoformans JEC21] Length = 909 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 363 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 422 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 423 EFMVKESGHITKGVLESDYTDEYWERRY 450 >KIS01248.1 gamma-tubulin complex component 2 [Cryptococcus gattii VGII 2001/935-1] Length = 909 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 364 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 423 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 424 EFMVKESGHITKGVLESDYTDEYWERRY 451 >KIR40592.1 gamma-tubulin complex component 2 [Cryptococcus gattii VGII Ram5] KIY55243.1 gamma-tubulin complex component 2 [Cryptococcus gattii VGII 99/473] Length = 909 Score = 114 bits (286), Expect = 2e-27 Identities = 52/88 (59%), Positives = 66/88 (75%) Frame = -1 Query: 322 EGSIVKGGEVLAVLEDRVMKTLGDPIASKLYSDLLLKASQPYCRMLIQWVTRGVLDDPYE 143 +G V GGEVL ++ +R GDP AS L+S LLL ASQPYC+MLIQW+ G L DP++ Sbjct: 364 DGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLHASQPYCKMLIQWIATGHLSDPFD 423 Query: 142 EFIIKESKSITRGTLEMDFTDEYWERKY 59 EF++KES IT+G LE D+TDEYWER+Y Sbjct: 424 EFMVKESGHITKGVLESDYTDEYWERRY 451