BLASTX nr result
ID: Phellodendron21_contig00017854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00017854 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006491244.1 PREDICTED: probable WRKY transcription factor 46 ... 79 3e-15 XP_006444876.1 hypothetical protein CICLE_v10020744mg [Citrus cl... 79 3e-15 AMO00383.1 WRKY transcription factor 15 [Manihot esculenta] OAY4... 74 1e-13 XP_012083322.1 PREDICTED: probable WRKY transcription factor 30 ... 74 1e-13 AEO31476.2 WRKY transcription factor 6-1 [Dimocarpus longan] 72 9e-13 XP_002511908.1 PREDICTED: probable WRKY transcription factor 53 ... 71 1e-12 XP_002302620.1 hypothetical protein POPTR_0002s17010g [Populus t... 70 5e-12 XP_011023206.1 PREDICTED: probable WRKY transcription factor 46 ... 69 7e-12 XP_012083242.1 PREDICTED: probable WRKY transcription factor 46 ... 69 9e-12 XP_002320852.2 hypothetical protein POPTR_0014s09190g [Populus t... 68 2e-11 ACV92008.1 WRKY transcription factor 6 [(Populus tomentosa x Pop... 67 3e-11 XP_011037871.1 PREDICTED: probable WRKY transcription factor 46 ... 67 4e-11 XP_007051596.2 PREDICTED: probable WRKY transcription factor 46 ... 64 7e-10 EOX95753.1 WRKY DNA-binding protein 46, putative [Theobroma cacao] 64 7e-10 OMO64319.1 DNA-binding WRKY [Corchorus capsularis] 62 2e-09 XP_010095789.1 putative WRKY transcription factor 46 [Morus nota... 62 3e-09 XP_002297983.1 WRKY transcription factor 41 family protein [Popu... 62 3e-09 OMP08603.1 DNA-binding WRKY [Corchorus olitorius] 62 4e-09 GAV56913.1 WRKY domain-containing protein [Cephalotus follicularis] 62 4e-09 ALB35159.1 WRKY transcription factor 46-like protein [Morus alba] 62 4e-09 >XP_006491244.1 PREDICTED: probable WRKY transcription factor 46 [Citrus sinensis] KDO86417.1 hypothetical protein CISIN_1g017895mg [Citrus sinensis] Length = 364 Score = 78.6 bits (192), Expect = 3e-15 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MDR+Q ILI+EL GK+LAK+LRNHLN SSSPETR++L+Q ILSSYEKA Sbjct: 6 MDRDQNILITELAQGKELAKRLRNHLNPSSSPETREFLVQEILSSYEKA 54 >XP_006444876.1 hypothetical protein CICLE_v10020744mg [Citrus clementina] ESR58116.1 hypothetical protein CICLE_v10020744mg [Citrus clementina] Length = 364 Score = 78.6 bits (192), Expect = 3e-15 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MDR+Q ILI+EL GK+LAK+LRNHLN SSSPETR++L+Q ILSSYEKA Sbjct: 6 MDRDQNILITELAQGKELAKRLRNHLNPSSSPETREFLVQEILSSYEKA 54 >AMO00383.1 WRKY transcription factor 15 [Manihot esculenta] OAY49115.1 hypothetical protein MANES_05G030900 [Manihot esculenta] Length = 352 Score = 73.9 bits (180), Expect = 1e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MD EQKILISEL GK+LA++LR HLNS SSPE+RQ+L++ ILSSYEKA Sbjct: 5 MDCEQKILISELNQGKELAERLRKHLNSISSPESRQFLVEQILSSYEKA 53 >XP_012083322.1 PREDICTED: probable WRKY transcription factor 30 [Jatropha curcas] AGQ04243.1 WRKY transcription factor 51.1 [Jatropha curcas] KDP28582.1 hypothetical protein JCGZ_14353 [Jatropha curcas] Length = 314 Score = 73.6 bits (179), Expect = 1e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MDREQK LISELT GK+ +QLR HL S SSPETRQ+L++ ILSSYEKA Sbjct: 1 MDREQKTLISELTQGKEHTEQLRKHLTSLSSPETRQFLVEKILSSYEKA 49 >AEO31476.2 WRKY transcription factor 6-1 [Dimocarpus longan] Length = 352 Score = 71.6 bits (174), Expect = 9e-13 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MDRE +L ELT GK+LAKQLRNHLN SSS +TR YLIQ IL SYEKA Sbjct: 1 MDRELMVLEKELTQGKELAKQLRNHLNPSSSNQTRDYLIQKILGSYEKA 49 >XP_002511908.1 PREDICTED: probable WRKY transcription factor 53 [Ricinus communis] EEF50577.1 WRKY transcription factor, putative [Ricinus communis] Length = 333 Score = 71.2 bits (173), Expect = 1e-12 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 M+REQKIL++ELT GK+LA+QLRNHLN+ SS E RQ L++ ILSSYEKA Sbjct: 1 MEREQKILVNELTQGKELAEQLRNHLNNISSFEMRQGLVEQILSSYEKA 49 >XP_002302620.1 hypothetical protein POPTR_0002s17010g [Populus trichocarpa] EEE81893.1 hypothetical protein POPTR_0002s17010g [Populus trichocarpa] Length = 363 Score = 69.7 bits (169), Expect = 5e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 M+ EQK L+SEL GK+LAKQLRNHLN SSS E RQ L++ ILSSYEKA Sbjct: 5 MEWEQKTLVSELAQGKELAKQLRNHLNPSSSLEARQSLVEKILSSYEKA 53 >XP_011023206.1 PREDICTED: probable WRKY transcription factor 46 [Populus euphratica] Length = 364 Score = 69.3 bits (168), Expect = 7e-12 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 M+ EQK L+SEL GK+LAKQLRNHLN SSS E RQ+L++ IL SYEKA Sbjct: 5 MEWEQKTLVSELAQGKELAKQLRNHLNPSSSLEARQFLVEKILFSYEKA 53 >XP_012083242.1 PREDICTED: probable WRKY transcription factor 46 [Jatropha curcas] AGQ04246.1 WRKY transcription factor 52 [Jatropha curcas] KDP28510.1 hypothetical protein JCGZ_14281 [Jatropha curcas] ALU34123.1 WRKY transcription factor [Jatropha curcas] Length = 293 Score = 68.6 bits (166), Expect = 9e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MD EQK LI+EL+ GK+LA+QLRNHLN SSS ETR +L+ +LSSYEKA Sbjct: 1 MDLEQKNLINELSQGKELAEQLRNHLNPSSSLETRLFLVDKLLSSYEKA 49 >XP_002320852.2 hypothetical protein POPTR_0014s09190g [Populus trichocarpa] EEE99167.2 hypothetical protein POPTR_0014s09190g [Populus trichocarpa] Length = 365 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 M+ E K LISELT GK+LAKQL NHLN S+S E RQ+L+ ILSSYEKA Sbjct: 5 MEWEHKTLISELTQGKELAKQLSNHLNPSASLEARQFLVDKILSSYEKA 53 >ACV92008.1 WRKY transcription factor 6 [(Populus tomentosa x Populus bolleana) x Populus tomentosa] Length = 369 Score = 67.4 bits (163), Expect = 3e-11 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 M+ E K LISEL+ GK+LAKQL NHLN SSS E RQ+L+ ILSSYEKA Sbjct: 5 MEWEHKTLISELSQGKELAKQLSNHLNPSSSLEARQFLVDKILSSYEKA 53 >XP_011037871.1 PREDICTED: probable WRKY transcription factor 46 [Populus euphratica] Length = 363 Score = 67.0 bits (162), Expect = 4e-11 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 M+ E K LISELT GK+LAKQL NHLN SSS E Q+L+ ILSSYEKA Sbjct: 5 MEWEHKTLISELTQGKELAKQLSNHLNPSSSLEAHQFLVDKILSSYEKA 53 >XP_007051596.2 PREDICTED: probable WRKY transcription factor 46 [Theobroma cacao] Length = 352 Score = 63.5 bits (153), Expect = 7e-10 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MD EQK L++ELT GK L LR HL+ SSSPETRQ L++ IL SYEKA Sbjct: 5 MDWEQKTLLNELTQGKQLTNLLRQHLHPSSSPETRQDLLEKILCSYEKA 53 >EOX95753.1 WRKY DNA-binding protein 46, putative [Theobroma cacao] Length = 352 Score = 63.5 bits (153), Expect = 7e-10 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MD EQK L++ELT GK L LR HL+ SSSPETRQ L++ IL SYEKA Sbjct: 5 MDWEQKTLLNELTQGKQLTNLLRQHLHPSSSPETRQDLLEKILCSYEKA 53 >OMO64319.1 DNA-binding WRKY [Corchorus capsularis] Length = 337 Score = 62.4 bits (150), Expect = 2e-09 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -1 Query: 152 IMDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 +MD EQK L++ELT G++L LR HL+ SSSP+TRQ L++ IL SYEKA Sbjct: 1 MMDWEQKTLLNELTQGRELTNLLRKHLHPSSSPQTRQALLEKILFSYEKA 50 >XP_010095789.1 putative WRKY transcription factor 46 [Morus notabilis] EXB62209.1 putative WRKY transcription factor 46 [Morus notabilis] Length = 364 Score = 62.0 bits (149), Expect = 3e-09 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -1 Query: 140 EQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 EQK LI+EL GK+LAKQL NHL SSPE R +L+ ILSSYEKA Sbjct: 8 EQKTLINELIQGKELAKQLMNHLQPFSSPEKRNFLVGKILSSYEKA 53 >XP_002297983.1 WRKY transcription factor 41 family protein [Populus trichocarpa] EEE82788.1 WRKY transcription factor 41 family protein [Populus trichocarpa] Length = 338 Score = 61.6 bits (148), Expect = 3e-09 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 140 EQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 EQK LI+EL G +LAKQLR HLN++SS ETR L++ ILSSYEKA Sbjct: 8 EQKTLITELIQGMELAKQLRAHLNATSSVETRDMLVRRILSSYEKA 53 >OMP08603.1 DNA-binding WRKY [Corchorus olitorius] Length = 345 Score = 61.6 bits (148), Expect = 4e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -1 Query: 152 IMDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 +MD EQK L++ELT G++L LR HL+ SSSP TRQ L++ IL SYEKA Sbjct: 1 MMDWEQKTLLNELTQGRELTNLLRKHLHPSSSPHTRQALLEKILFSYEKA 50 >GAV56913.1 WRKY domain-containing protein [Cephalotus follicularis] Length = 361 Score = 61.6 bits (148), Expect = 4e-09 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 MD E+ LI+EL GK+L +QLR HLNS S+ ETRQ+L++ IL SYEKA Sbjct: 5 MDTERIPLINELNQGKELTEQLRKHLNSFSANETRQFLVEKILGSYEKA 53 >ALB35159.1 WRKY transcription factor 46-like protein [Morus alba] Length = 364 Score = 61.6 bits (148), Expect = 4e-09 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = -1 Query: 149 MDREQKILISELTHGKDLAKQLRNHLNSSSSPETRQYLIQNILSSYEKA 3 M+ EQK LI+EL GK+LAKQL+NHL SS E R +L+ ILSSYEKA Sbjct: 5 MNLEQKTLINELIQGKELAKQLKNHLQPFSSQEKRNFLVGKILSSYEKA 53