BLASTX nr result
ID: Phellodendron21_contig00017619
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00017619 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO86313.1 hypothetical protein CISIN_1g0032381mg, partial [Citr... 66 1e-11 OIT27488.1 exocyst complex component sec10 [Nicotiana attenuata] 66 4e-11 GAU36834.1 hypothetical protein TSUD_213570 [Trifolium subterran... 65 1e-10 OMO99171.1 Exocyst complex component Sec10-like protein, partial... 66 1e-09 XP_009783874.1 PREDICTED: exocyst complex component SEC10-like [... 66 1e-09 XP_016509593.1 PREDICTED: exocyst complex component SEC10-like, ... 66 2e-09 OMO96275.1 Exocyst complex component Sec10-like protein [Corchor... 66 2e-09 EOY20542.1 Exocyst complex component sec10 isoform 6, partial [T... 66 2e-09 XP_003627461.2 exocyst complex component Sec10 [Medicago truncat... 66 2e-09 OMO71940.1 Exocyst complex component Sec10-like protein [Corchor... 66 2e-09 XP_017979128.1 PREDICTED: exocyst complex component SEC10 [Theob... 66 2e-09 XP_007036040.2 PREDICTED: exocyst complex component SEC10 isofor... 66 2e-09 EOY20541.1 Exocyst complex component sec10 isoform 5 [Theobroma ... 66 2e-09 EOY25457.1 Exocyst complex component sec10 isoform 2 [Theobroma ... 66 2e-09 XP_011023274.1 PREDICTED: LOW QUALITY PROTEIN: exocyst complex c... 66 2e-09 XP_009625553.1 PREDICTED: exocyst complex component SEC10 [Nicot... 66 2e-09 XP_015584521.1 PREDICTED: exocyst complex component SEC10 [Ricin... 66 2e-09 XP_002301373.1 hypothetical protein POPTR_0002s16570g [Populus t... 66 2e-09 XP_006444951.1 hypothetical protein CICLE_v10018853mg [Citrus cl... 66 2e-09 XP_004235214.1 PREDICTED: exocyst complex component SEC10 [Solan... 66 2e-09 >KDO86313.1 hypothetical protein CISIN_1g0032381mg, partial [Citrus sinensis] Length = 53 Score = 65.9 bits (159), Expect = 1e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 6 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 37 >OIT27488.1 exocyst complex component sec10 [Nicotiana attenuata] Length = 102 Score = 65.9 bits (159), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 55 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 86 >GAU36834.1 hypothetical protein TSUD_213570 [Trifolium subterraneum] Length = 104 Score = 64.7 bits (156), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLR+DYK Sbjct: 60 IVAPESLSTLFEGTPSIRKDAQRFIQLRDDYK 91 >OMO99171.1 Exocyst complex component Sec10-like protein, partial [Corchorus capsularis] Length = 306 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 261 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 292 >XP_009783874.1 PREDICTED: exocyst complex component SEC10-like [Nicotiana sylvestris] Length = 401 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 354 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 385 >XP_016509593.1 PREDICTED: exocyst complex component SEC10-like, partial [Nicotiana tabacum] Length = 605 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 558 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 589 >OMO96275.1 Exocyst complex component Sec10-like protein [Corchorus olitorius] Length = 811 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 766 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 797 >EOY20542.1 Exocyst complex component sec10 isoform 6, partial [Theobroma cacao] Length = 814 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 780 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 811 >XP_003627461.2 exocyst complex component Sec10 [Medicago truncatula] AET01937.2 exocyst complex component Sec10 [Medicago truncatula] Length = 821 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 777 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 808 >OMO71940.1 Exocyst complex component Sec10-like protein [Corchorus capsularis] Length = 825 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 780 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 811 >XP_017979128.1 PREDICTED: exocyst complex component SEC10 [Theobroma cacao] Length = 827 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 780 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 811 >XP_007036040.2 PREDICTED: exocyst complex component SEC10 isoform X1 [Theobroma cacao] XP_017973645.1 PREDICTED: exocyst complex component SEC10 isoform X1 [Theobroma cacao] Length = 827 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 780 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 811 >EOY20541.1 Exocyst complex component sec10 isoform 5 [Theobroma cacao] Length = 827 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 780 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 811 >EOY25457.1 Exocyst complex component sec10 isoform 2 [Theobroma cacao] Length = 828 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 781 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 812 >XP_011023274.1 PREDICTED: LOW QUALITY PROTEIN: exocyst complex component SEC10-like [Populus euphratica] Length = 832 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 785 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 816 >XP_009625553.1 PREDICTED: exocyst complex component SEC10 [Nicotiana tomentosiformis] Length = 833 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 786 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 817 >XP_015584521.1 PREDICTED: exocyst complex component SEC10 [Ricinus communis] XP_015584522.1 PREDICTED: exocyst complex component SEC10 [Ricinus communis] EEF50588.1 sec10, putative [Ricinus communis] Length = 834 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 789 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 820 >XP_002301373.1 hypothetical protein POPTR_0002s16570g [Populus trichocarpa] EEE80646.1 hypothetical protein POPTR_0002s16570g [Populus trichocarpa] Length = 836 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 790 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 821 >XP_006444951.1 hypothetical protein CICLE_v10018853mg [Citrus clementina] XP_006491187.1 PREDICTED: exocyst complex component SEC10 [Citrus sinensis] ESR58191.1 hypothetical protein CICLE_v10018853mg [Citrus clementina] Length = 837 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 790 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 821 >XP_004235214.1 PREDICTED: exocyst complex component SEC10 [Solanum lycopersicum] XP_010318221.1 PREDICTED: exocyst complex component SEC10 [Solanum lycopersicum] Length = 837 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 501 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 406 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK Sbjct: 790 IVAPESLSTLFEGTPSIRKDAQRFIQLREDYK 821