BLASTX nr result
ID: Phellodendron21_contig00017499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00017499 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO83735.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] 98 3e-22 XP_006473057.1 PREDICTED: tubby-like F-box protein 8 [Citrus sin... 98 3e-22 XP_006434458.1 hypothetical protein CICLE_v10001251mg [Citrus cl... 98 3e-22 XP_017226195.1 PREDICTED: tubby-like F-box protein 8 [Daucus car... 95 5e-21 XP_004290516.1 PREDICTED: tubby-like F-box protein 8 [Fragaria v... 93 3e-20 XP_008381822.1 PREDICTED: tubby-like F-box protein 8 [Malus dome... 92 8e-20 XP_008237579.1 PREDICTED: tubby-like F-box protein 8 [Prunus mume] 91 2e-19 XP_007201025.1 hypothetical protein PRUPE_ppa006121mg [Prunus pe... 91 2e-19 NP_001280941.1 tubby-like F-box protein 8 [Malus domestica] ADL3... 91 2e-19 XP_015886435.1 PREDICTED: tubby-like F-box protein 8 [Ziziphus j... 89 8e-19 CAN82256.1 hypothetical protein VITISV_009404 [Vitis vinifera] 89 8e-19 GAV61895.1 F-box domain-containing protein/Tub domain-containing... 89 1e-18 XP_018842121.1 PREDICTED: tubby-like F-box protein 8 isoform X1 ... 89 1e-18 XP_002267914.1 PREDICTED: tubby-like F-box protein 8 [Vitis vini... 89 1e-18 XP_009351377.1 PREDICTED: tubby-like F-box protein 8 [Pyrus x br... 88 2e-18 XP_018848170.1 PREDICTED: tubby-like F-box protein 8 [Juglans re... 88 2e-18 XP_012080754.1 PREDICTED: tubby-like F-box protein 8 [Jatropha c... 87 4e-18 XP_008445764.1 PREDICTED: tubby-like F-box protein 8 [Cucumis melo] 87 4e-18 XP_004140892.1 PREDICTED: tubby-like F-box protein 8 [Cucumis sa... 87 4e-18 XP_018853796.1 PREDICTED: tubby-like F-box protein 13 [Juglans r... 82 5e-18 >KDO83735.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] Length = 396 Score = 98.2 bits (243), Expect = 3e-22 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHELHDQPVV Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKSHGSVHELHDQPVV 48 >XP_006473057.1 PREDICTED: tubby-like F-box protein 8 [Citrus sinensis] XP_006473058.1 PREDICTED: tubby-like F-box protein 8 [Citrus sinensis] XP_015384310.1 PREDICTED: tubby-like F-box protein 8 [Citrus sinensis] KDO83731.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] KDO83732.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] KDO83733.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] KDO83734.1 hypothetical protein CISIN_1g014365mg [Citrus sinensis] Length = 426 Score = 98.2 bits (243), Expect = 3e-22 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHELHDQPVV Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKSHGSVHELHDQPVV 48 >XP_006434458.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] XP_006434459.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] ESR47698.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] ESR47699.1 hypothetical protein CICLE_v10001251mg [Citrus clementina] Length = 426 Score = 98.2 bits (243), Expect = 3e-22 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHELHDQPVV Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKSHGSVHELHDQPVV 48 >XP_017226195.1 PREDICTED: tubby-like F-box protein 8 [Daucus carota subsp. sativus] XP_017226201.1 PREDICTED: tubby-like F-box protein 8 [Daucus carota subsp. sativus] KZN08604.1 hypothetical protein DCAR_001134 [Daucus carota subsp. sativus] Length = 433 Score = 95.1 bits (235), Expect = 5e-21 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFG LSRRGFEVRLPG H RGKSHG+VHELHDQPVV Sbjct: 1 MSFRSIVRDVRDGFGGLSRRGFEVRLPGQHQRGKSHGAVHELHDQPVV 48 >XP_004290516.1 PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] XP_011458506.1 PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] Length = 429 Score = 92.8 bits (229), Expect = 3e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHELHDQP+V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH-RGKSHGSVHELHDQPLV 47 >XP_008381822.1 PREDICTED: tubby-like F-box protein 8 [Malus domestica] Length = 426 Score = 91.7 bits (226), Expect = 8e-20 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHE+HDQP+V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH-RGKSHGSVHEVHDQPLV 47 >XP_008237579.1 PREDICTED: tubby-like F-box protein 8 [Prunus mume] Length = 426 Score = 90.5 bits (223), Expect = 2e-19 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHELHD P+V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH-RGKSHGSVHELHDPPLV 47 >XP_007201025.1 hypothetical protein PRUPE_ppa006121mg [Prunus persica] ONH90002.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90003.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90004.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90005.1 hypothetical protein PRUPE_8G029200 [Prunus persica] ONH90006.1 hypothetical protein PRUPE_8G029200 [Prunus persica] Length = 426 Score = 90.5 bits (223), Expect = 2e-19 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHELHD P+V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH-RGKSHGSVHELHDPPLV 47 >NP_001280941.1 tubby-like F-box protein 8 [Malus domestica] ADL36842.1 TLP domain class transcription factor [Malus domestica] Length = 426 Score = 90.5 bits (223), Expect = 2e-19 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHE+HDQP V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH-RGKSHGSVHEVHDQPSV 47 >XP_015886435.1 PREDICTED: tubby-like F-box protein 8 [Ziziphus jujuba] XP_015886436.1 PREDICTED: tubby-like F-box protein 8 [Ziziphus jujuba] Length = 425 Score = 89.0 bits (219), Expect = 8e-19 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHELH+ P+V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH-RGKSHGSVHELHEPPLV 47 >CAN82256.1 hypothetical protein VITISV_009404 [Vitis vinifera] Length = 380 Score = 88.6 bits (218), Expect = 8e-19 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR F+VRLPGHH RGKSHGSVHEL DQP+V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHH-RGKSHGSVHELQDQPLV 47 >GAV61895.1 F-box domain-containing protein/Tub domain-containing protein [Cephalotus follicularis] Length = 424 Score = 88.6 bits (218), Expect = 1e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSI+RDVRDGFGSLSRR FEVRL GHH RGKSHGSVHELHDQP+V Sbjct: 1 MSFRSIMRDVRDGFGSLSRRSFEVRLSGHH-RGKSHGSVHELHDQPLV 47 >XP_018842121.1 PREDICTED: tubby-like F-box protein 8 isoform X1 [Juglans regia] XP_018842122.1 PREDICTED: tubby-like F-box protein 8 isoform X1 [Juglans regia] Length = 425 Score = 88.6 bits (218), Expect = 1e-18 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRRGFEVRL GHH RGKSHGS+H+LHD PV+ Sbjct: 1 MSFRSIVRDVRDGFGSLSRRGFEVRLAGHH-RGKSHGSLHDLHDHPVI 47 >XP_002267914.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_010665127.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_010665128.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_010665129.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_019072257.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] XP_019072258.1 PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] Length = 425 Score = 88.6 bits (218), Expect = 1e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR F+VRLPGHH RGKSHGSVHEL DQP+V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHH-RGKSHGSVHELQDQPLV 47 >XP_009351377.1 PREDICTED: tubby-like F-box protein 8 [Pyrus x bretschneideri] Length = 426 Score = 88.2 bits (217), Expect = 2e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FEVRLPGHH RGKSHGSVHE+HDQ +V Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHH-RGKSHGSVHEVHDQHLV 47 >XP_018848170.1 PREDICTED: tubby-like F-box protein 8 [Juglans regia] XP_018848171.1 PREDICTED: tubby-like F-box protein 8 [Juglans regia] Length = 434 Score = 87.8 bits (216), Expect = 2e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDG GSLSRR FEVRLP HH RGKSHGSVHELHDQP++ Sbjct: 1 MSFRSIVRDVRDGLGSLSRRSFEVRLPSHH-RGKSHGSVHELHDQPLI 47 >XP_012080754.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080755.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080756.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080757.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080758.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] XP_012080759.1 PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] KDP30771.1 hypothetical protein JCGZ_15200 [Jatropha curcas] Length = 424 Score = 87.0 bits (214), Expect = 4e-18 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDGFGSLSRR FE+RLPGHH RGKSH SV ELHDQPVV Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFELRLPGHH-RGKSHSSVSELHDQPVV 47 >XP_008445764.1 PREDICTED: tubby-like F-box protein 8 [Cucumis melo] Length = 430 Score = 87.0 bits (214), Expect = 4e-18 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVR+GFGSLSRR FEVRLPG H RGKSHGSVH+LHDQP+V Sbjct: 1 MSFRSIVRDVREGFGSLSRRSFEVRLPG-HQRGKSHGSVHDLHDQPLV 47 >XP_004140892.1 PREDICTED: tubby-like F-box protein 8 [Cucumis sativus] KGN46018.1 hypothetical protein Csa_6G043990 [Cucumis sativus] Length = 430 Score = 87.0 bits (214), Expect = 4e-18 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVR+GFGSLSRR FEVRLPG H RGKSHGSVH+LHDQP+V Sbjct: 1 MSFRSIVRDVREGFGSLSRRSFEVRLPG-HQRGKSHGSVHDLHDQPLV 47 >XP_018853796.1 PREDICTED: tubby-like F-box protein 13 [Juglans regia] XP_018853797.1 PREDICTED: tubby-like F-box protein 13 [Juglans regia] XP_018853798.1 PREDICTED: tubby-like F-box protein 13 [Juglans regia] XP_018853799.1 PREDICTED: tubby-like F-box protein 13 [Juglans regia] XP_018853800.1 PREDICTED: tubby-like F-box protein 13 [Juglans regia] XP_018853801.1 PREDICTED: tubby-like F-box protein 13 [Juglans regia] XP_018853803.1 PREDICTED: tubby-like F-box protein 13 [Juglans regia] Length = 153 Score = 82.4 bits (202), Expect = 5e-18 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = +2 Query: 137 MSFRSIVRDVRDGFGSLSRRGFEVRLPGHHDRGKSHGSVHELHDQPVV 280 MSFRSIVRDVRDG GSLSRR EVRLP H RGKSHGSVHELHDQP+V Sbjct: 4 MSFRSIVRDVRDGLGSLSRRSIEVRLP-RHPRGKSHGSVHELHDQPLV 50