BLASTX nr result
ID: Phellodendron21_contig00017086
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00017086 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414323.1 hypothetical protein MELLADRAFT_91428 [Melampsora... 99 7e-22 >XP_007414323.1 hypothetical protein MELLADRAFT_91428 [Melampsora larici-populina 98AG31] EGG02338.1 hypothetical protein MELLADRAFT_91428 [Melampsora larici-populina 98AG31] Length = 929 Score = 99.0 bits (245), Expect = 7e-22 Identities = 56/108 (51%), Positives = 66/108 (61%), Gaps = 2/108 (1%) Frame = +1 Query: 1 PVTKPQVYQTPGRRTVSEPKP-SVSVRKQSLFGNQD-EVTGAPRGYKRVTFAEESLDSRR 174 P T+ VYQ PGRRTVS+PKP S+ + K+SL G + E+ APRGYKRVTFAEE +RR Sbjct: 811 PRTESLVYQPPGRRTVSDPKPTSLLIHKRSLIGAKSTELPAAPRGYKRVTFAEEPARARR 870 Query: 175 VVSYGXXXXXXXXXXXXXXXXXXXMERLRRAASPRNFSVLGSTHPNFL 318 VVSYG MERLR A +PR SVL + HPN L Sbjct: 871 VVSYGETDDGEERAAPRVTSVDIAMERLREAGAPRRLSVLSNNHPNLL 918