BLASTX nr result
ID: Phellodendron21_contig00017070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00017070 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH92508.1 Aldolase-type TIM barrel, partial [Cynara cardunculus... 79 8e-15 KDO79093.1 hypothetical protein CISIN_1g013813mg [Citrus sinensis] 69 1e-12 XP_006494482.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 69 1e-12 XP_006425966.1 hypothetical protein CICLE_v10025630mg [Citrus cl... 69 1e-12 XP_002283225.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 69 1e-12 XP_008811934.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 68 1e-12 CBI21377.3 unnamed protein product, partial [Vitis vinifera] 69 1e-12 XP_002533266.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 69 1e-12 KDO79094.1 hypothetical protein CISIN_1g013813mg [Citrus sinensis] 69 1e-12 XP_018845018.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 68 2e-12 XP_015870678.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 68 2e-12 XP_004509110.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 68 2e-12 XP_015870862.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 68 2e-12 GAU38289.1 hypothetical protein TSUD_157740 [Trifolium subterran... 68 2e-12 KCW45260.1 hypothetical protein EUGRSUZ_L01089, partial [Eucalyp... 68 2e-12 XP_010026511.2 PREDICTED: tRNA-dihydrouridine(16/17) synthase [N... 68 2e-12 KCW59470.1 hypothetical protein EUGRSUZ_H022182, partial [Eucaly... 68 3e-12 JAT53837.1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like,... 68 4e-12 AGW24469.1 tRNA-dihydrouridine synthase, partial [Avicennia mari... 67 4e-12 XP_006393920.1 hypothetical protein EUTSA_v10004143mg [Eutrema s... 67 5e-12 >KVH92508.1 Aldolase-type TIM barrel, partial [Cynara cardunculus var. scolymus] Length = 472 Score = 79.0 bits (193), Expect = 8e-15 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 3/77 (3%) Frame = +2 Query: 131 RIALYLFNFVPMI*TYCWMLQGEFFL---DMPMHFGLFTLACSRCPQRIARRGNYGAFLM 301 +I YLFNFV MI T W + L + + +G +CPQRIA+RGNYGAFLM Sbjct: 186 KIGHYLFNFVRMIQTLYWRQHAGWSLIAITLTLIWGKLLELLFKCPQRIAKRGNYGAFLM 245 Query: 302 DNLPLVKSLVEKLALNL 352 D LPLVKSLVEKLALNL Sbjct: 246 DKLPLVKSLVEKLALNL 262 >KDO79093.1 hypothetical protein CISIN_1g013813mg [Citrus sinensis] Length = 436 Score = 69.3 bits (168), Expect(2) = 1e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 192 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 224 Score = 30.8 bits (68), Expect(2) = 1e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 153 TCK---EDRPLFVQFCAN 167 >XP_006494482.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Citrus sinensis] Length = 436 Score = 69.3 bits (168), Expect(2) = 1e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 192 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 224 Score = 30.8 bits (68), Expect(2) = 1e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 153 TCK---EDRPLFVQFCAN 167 >XP_006425966.1 hypothetical protein CICLE_v10025630mg [Citrus clementina] ESR39206.1 hypothetical protein CICLE_v10025630mg [Citrus clementina] Length = 436 Score = 69.3 bits (168), Expect(2) = 1e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 192 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 224 Score = 30.8 bits (68), Expect(2) = 1e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 153 TCK---EDRPLFVQFCAN 167 >XP_002283225.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Vitis vinifera] Length = 424 Score = 69.3 bits (168), Expect(2) = 1e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 181 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 213 Score = 30.8 bits (68), Expect(2) = 1e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 142 TCK---EDRPLFVQFCAN 156 >XP_008811934.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Phoenix dactylifera] Length = 326 Score = 68.2 bits (165), Expect(2) = 1e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKL+LNL Sbjct: 79 CPQRIARRGNYGAFLMDNLPLVKSLVEKLSLNL 111 Score = 32.0 bits (71), Expect(2) = 1e-12 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 124 LLEDRPLFVQFCAN 165 ++EDRPLFVQFCAN Sbjct: 41 IMEDRPLFVQFCAN 54 >CBI21377.3 unnamed protein product, partial [Vitis vinifera] Length = 316 Score = 69.3 bits (168), Expect(2) = 1e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 157 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 189 Score = 30.8 bits (68), Expect(2) = 1e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 118 TCK---EDRPLFVQFCAN 132 >XP_002533266.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Ricinus communis] EEF29128.1 tRNA-dihydrouridine synthase, putative [Ricinus communis] Length = 426 Score = 69.3 bits (168), Expect(2) = 1e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 180 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 212 Score = 30.4 bits (67), Expect(2) = 1e-12 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 130 EDRPLFVQFCAN 165 EDRPLFVQFCAN Sbjct: 144 EDRPLFVQFCAN 155 >KDO79094.1 hypothetical protein CISIN_1g013813mg [Citrus sinensis] Length = 287 Score = 69.3 bits (168), Expect(2) = 1e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 43 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 75 Score = 30.4 bits (67), Expect(2) = 1e-12 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 130 EDRPLFVQFCAN 165 EDRPLFVQFCAN Sbjct: 7 EDRPLFVQFCAN 18 >XP_018845018.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Juglans regia] XP_018845019.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Juglans regia] Length = 444 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLV+KLALNL Sbjct: 197 CPQRIARRGNYGAFLMDNLPLVKSLVQKLALNL 229 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 158 TCK---EDRPLFVQFCAN 172 >XP_015870678.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Ziziphus jujuba] XP_015870713.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Ziziphus jujuba] XP_015870768.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Ziziphus jujuba] XP_015872137.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Ziziphus jujuba] Length = 440 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLV+KLALNL Sbjct: 194 CPQRIARRGNYGAFLMDNLPLVKSLVQKLALNL 226 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 155 TCK---EDRPLFVQFCAN 169 >XP_004509110.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Cicer arietinum] Length = 416 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIA+RGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 160 CPQRIAKRGNYGAFLMDNLPLVKSLVEKLALNL 192 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 121 TCK---EDRPLFVQFCAN 135 >XP_015870862.1 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like, partial [Ziziphus jujuba] Length = 399 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLV+KLALNL Sbjct: 153 CPQRIARRGNYGAFLMDNLPLVKSLVQKLALNL 185 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 114 TCK---EDRPLFVQFCAN 128 >GAU38289.1 hypothetical protein TSUD_157740 [Trifolium subterraneum] Length = 377 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIA+RGNYGAFLMDNLPLVKSLVEKLALNL Sbjct: 132 CPQRIAKRGNYGAFLMDNLPLVKSLVEKLALNL 164 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 93 TCK---EDRPLFVQFCAN 107 >KCW45260.1 hypothetical protein EUGRSUZ_L01089, partial [Eucalyptus grandis] Length = 336 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLV+KLALNL Sbjct: 193 CPQRIARRGNYGAFLMDNLPLVKSLVQKLALNL 225 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 154 TCK---EDRPLFVQFCAN 168 >XP_010026511.2 PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Eucalyptus grandis] Length = 327 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLV+KLALNL Sbjct: 83 CPQRIARRGNYGAFLMDNLPLVKSLVQKLALNL 115 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 44 TCK---EDRPLFVQFCAN 58 >KCW59470.1 hypothetical protein EUGRSUZ_H022182, partial [Eucalyptus grandis] Length = 281 Score = 68.2 bits (165), Expect(2) = 3e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLV+KLALNL Sbjct: 37 CPQRIARRGNYGAFLMDNLPLVKSLVQKLALNL 69 Score = 30.4 bits (67), Expect(2) = 3e-12 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 130 EDRPLFVQFCAN 165 EDRPLFVQFCAN Sbjct: 1 EDRPLFVQFCAN 12 >JAT53837.1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like, partial [Anthurium amnicola] Length = 422 Score = 67.8 bits (164), Expect(2) = 4e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPL+KSLV+KLALNL Sbjct: 176 CPQRIARRGNYGAFLMDNLPLIKSLVQKLALNL 208 Score = 30.4 bits (67), Expect(2) = 4e-12 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 130 EDRPLFVQFCAN 165 EDRPLFVQFCAN Sbjct: 140 EDRPLFVQFCAN 151 >AGW24469.1 tRNA-dihydrouridine synthase, partial [Avicennia marina subsp. marina] Length = 106 Score = 67.0 bits (162), Expect = 4e-12 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLA NL Sbjct: 66 CPQRIARRGNYGAFLMDNLPLVKSLVEKLAKNL 98 >XP_006393920.1 hypothetical protein EUTSA_v10004143mg [Eutrema salsugineum] ESQ31206.1 hypothetical protein EUTSA_v10004143mg [Eutrema salsugineum] Length = 471 Score = 67.0 bits (162), Expect(2) = 5e-12 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +2 Query: 254 CPQRIARRGNYGAFLMDNLPLVKSLVEKLALNL 352 CPQRIARRGNYGAFLMDNLPLVKSLVEKLA NL Sbjct: 226 CPQRIARRGNYGAFLMDNLPLVKSLVEKLAQNL 258 Score = 30.8 bits (68), Expect(2) = 5e-12 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 112 SCKLLLEDRPLFVQFCAN 165 +CK EDRPLFVQFCAN Sbjct: 187 TCK---EDRPLFVQFCAN 201