BLASTX nr result
ID: Phellodendron21_contig00016909
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016909 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007410686.1 hypothetical protein MELLADRAFT_43674 [Melampsora... 83 3e-16 >XP_007410686.1 hypothetical protein MELLADRAFT_43674 [Melampsora larici-populina 98AG31] EGG06035.1 hypothetical protein MELLADRAFT_43674 [Melampsora larici-populina 98AG31] Length = 519 Score = 83.2 bits (204), Expect = 3e-16 Identities = 43/80 (53%), Positives = 52/80 (65%) Frame = +1 Query: 124 MPSKTSTKTSQVDPKSASIPVRVKDIPKLNPSNGLVTNGPXXXXXXKPDKVAYDREQGIF 303 MP KTS K+ DPKSASIP RVKD+ K+NP+ NG +PDK AY+REQ Sbjct: 1 MPPKTSQKSLPTDPKSASIPTRVKDVTKMNPNAVTPVNG-ASGSGGRPDKAAYEREQTSL 59 Query: 304 KTEIDVLQARLAIVREQIGD 363 K EID LQA++ +R QIGD Sbjct: 60 KVEIDTLQAKVTAIRAQIGD 79