BLASTX nr result
ID: Phellodendron21_contig00016767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016767 (556 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007404192.1 Hypothetical protein MELLADRAFT_86675 [Melampsora... 57 2e-06 >XP_007404192.1 Hypothetical protein MELLADRAFT_86675 [Melampsora larici-populina 98AG31] EGG13254.1 Hypothetical protein MELLADRAFT_86675 [Melampsora larici-populina 98AG31] Length = 593 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/68 (48%), Positives = 43/68 (63%) Frame = +1 Query: 1 QWLLENSIHVARNHNGNKNLSDNGPKVATHAPLLKPAKKLQIKTHMGARERRAGNIGGWF 180 +W L+++ A N N + KV+ +K A K Q K HMGAR+RRAGNIGGWF Sbjct: 533 EWPLDSN---AINPEPNDKALHHSNKVS----YVKRALKRQNKIHMGARDRRAGNIGGWF 585 Query: 181 DSLEEVEA 204 DSL+E+EA Sbjct: 586 DSLKEIEA 593