BLASTX nr result
ID: Phellodendron21_contig00016545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016545 (514 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007412644.1 hypothetical protein MELLADRAFT_37633 [Melampsora... 61 2e-09 EUB54489.1 Histone H4 [Echinococcus granulosus] 63 2e-09 XP_001539097.1 hypothetical protein HCAG_06702 [Histoplasma caps... 60 3e-09 ODN80104.1 histone H4 [Cryptococcus depauperatus CBS 7841] ODN85... 61 3e-09 OCF60153.1 histone H4 [Kwoniella mangroviensis CBS 10435] 61 3e-09 CAG26759.1 histone 4 [Ustilago maydis] 61 3e-09 XP_018278271.1 histone-fold-containing protein [Cutaneotrichospo... 61 3e-09 CDI53583.1 probable HHF1-histone H4 [Melanopsichium pennsylvanic... 61 3e-09 XP_568101.1 hypothetical protein CNL05670 [Cryptococcus neoforma... 61 3e-09 XP_007879582.1 hypothetical protein PFL1_03868 [Anthracocystis f... 61 3e-09 XP_007000995.1 hypothetical protein TREMEDRAFT_42124 [Tremella m... 61 3e-09 KNF02128.1 histone H4 [Puccinia striiformis f. sp. tritici PST-78] 61 3e-09 XP_003307442.1 histone H4 [Puccinia graminis f. sp. tritici CRL ... 61 3e-09 XP_013240198.1 hypothetical protein K437DRAFT_229481, partial [T... 60 3e-09 XP_018286973.1 hypothetical protein PHYBLDRAFT_188516 [Phycomyce... 61 3e-09 XP_013242893.1 hypothetical protein K437DRAFT_224727, partial [T... 60 4e-09 KNZ63047.1 histone H4 [Puccinia sorghi] 61 4e-09 XP_018738976.1 uncharacterized protein MSY001_0340 [Malassezia s... 61 4e-09 XP_001729476.1 hypothetical protein MGL_3511 [Malassezia globosa... 61 4e-09 KVI04940.1 Histone core [Cynara cardunculus var. scolymus] 63 5e-09 >XP_007412644.1 hypothetical protein MELLADRAFT_37633 [Melampsora larici-populina 98AG31] EGG04183.1 hypothetical protein MELLADRAFT_37633 [Melampsora larici-populina 98AG31] Length = 93 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 65 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 93 >EUB54489.1 Histone H4 [Echinococcus granulosus] Length = 175 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA*FPFLYPY 111 EHAKRKTVT++DVVYALKRQGRTLYGFG P+ PY Sbjct: 75 EHAKRKTVTAMDVVYALKRQGRTLYGFGGLRPYACPY 111 >XP_001539097.1 hypothetical protein HCAG_06702 [Histoplasma capsulatum NAm1] EDN09535.1 hypothetical protein HCAG_06702 [Histoplasma capsulatum NAm1] Length = 42 Score = 59.7 bits (143), Expect = 3e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFG 84 EHAKRKTVTSLDVVYALKRQGRTLYGFG Sbjct: 14 EHAKRKTVTSLDVVYALKRQGRTLYGFG 41 >ODN80104.1 histone H4 [Cryptococcus depauperatus CBS 7841] ODN85112.1 histone H4 [Cryptococcus depauperatus CBS 7841] ODO02408.1 histone H4 [Cryptococcus depauperatus CBS 7855] ODO04217.1 histone H4 [Cryptococcus depauperatus CBS 7855] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >OCF60153.1 histone H4 [Kwoniella mangroviensis CBS 10435] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >CAG26759.1 histone 4 [Ustilago maydis] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >XP_018278271.1 histone-fold-containing protein [Cutaneotrichosporon oleaginosus] KLT41780.1 histone-fold-containing protein [Cutaneotrichosporon oleaginosus] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >CDI53583.1 probable HHF1-histone H4 [Melanopsichium pennsylvanicum 4] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >XP_568101.1 hypothetical protein CNL05670 [Cryptococcus neoformans var. neoformans JEC21] XP_569504.1 hypothetical protein CNC01610 [Cryptococcus neoformans var. neoformans JEC21] XP_776348.1 hypothetical protein CNBC5650 [Cryptococcus neoformans var. neoformans B-3501A] XP_773502.1 hypothetical protein CNBI1160 [Cryptococcus neoformans var. neoformans B-3501A] XP_003192698.1 histone H4 protein; Hhf2p [Cryptococcus gattii WM276] XP_003193318.1 histone H4 [Cryptococcus gattii WM276] XP_012048871.1 histone H4 [Cryptococcus neoformans var. grubii H99] XP_012052665.1 histone H4 [Cryptococcus neoformans var. grubii H99] XP_014177836.1 hypothetical protein A1Q1_03936 [Trichosporon asahii var. asahii CBS 2479] XP_014183898.1 hypothetical protein A1Q1_00684 [Trichosporon asahii var. asahii CBS 2479] XP_018266155.1 histone H4 [Kwoniella dejecticola CBS 10117] XP_018264680.1 histone H4 [Kwoniella dejecticola CBS 10117] XP_018260197.1 histone H4 [Kwoniella dejecticola CBS 10117] XP_018998732.1 histone H4 [Cryptococcus amylolentus CBS 6039] XP_018992153.1 histone H4 [Cryptococcus amylolentus CBS 6039] XP_019006012.1 histone H4 [Kwoniella mangroviensis CBS 8507] XP_019004815.1 histone H4 [Kwoniella mangroviensis CBS 8507] XP_019003660.1 histone H4 [Kwoniella mangroviensis CBS 8507] XP_019014033.1 histone H4 [Kwoniella pini CBS 10737] XP_019012108.1 histone H4 [Kwoniella pini CBS 10737] XP_019009259.1 histone H4 [Kwoniella pini CBS 10737] XP_019031985.1 histone H4 [Tsuchiyaea wingfieldii CBS 7118] XP_019050342.1 histone H4 [Kwoniella bestiolae CBS 10118] XP_019048198.1 histone H4 [Kwoniella bestiolae CBS 10118] XP_019043438.1 histone H4 [Kwoniella bestiolae CBS 10118] EAL18855.1 hypothetical protein CNBI1160 [Cryptococcus neoformans var. neoformans B-3501A] EAL21701.1 hypothetical protein CNBC5650 [Cryptococcus neoformans var. neoformans B-3501A] AAW42197.1 hypothetical protein CNC01610 [Cryptococcus neoformans var. neoformans JEC21] AAW46584.1 hypothetical protein CNL05670 [Cryptococcus neoformans var. neoformans JEC21] ADV20911.1 Histone H4 protein, putative; Hhf2p [Cryptococcus gattii WM276] ADV21531.1 Histone H4 [Cryptococcus gattii WM276] EJT47307.1 hypothetical protein A1Q1_03936 [Trichosporon asahii var. asahii CBS 2479] EJT52937.1 hypothetical protein A1Q1_00684 [Trichosporon asahii var. asahii CBS 2479] AFR94317.1 histone H4 [Cryptococcus neoformans var. grubii H99] AFR97853.1 histone H4 [Cryptococcus neoformans var. grubii H99] EKC98831.1 hypothetical protein A1Q2_06878 [Trichosporon asahii var. asahii CBS 8904] EKD03503.1 hypothetical protein A1Q2_02221 [Trichosporon asahii var. asahii CBS 8904] KGB78235.1 histone H4 [Cryptococcus gattii VGII R265] KGB78793.1 histone H4 [Cryptococcus gattii VGII R265] KIR25209.1 histone H4 [Cryptococcus gattii VGII LA55] KIR27985.1 histone H4 [Cryptococcus gattii VGII LA55] KIR32668.1 histone H4 [Cryptococcus gattii VGII MMRL2647] KIR36579.1 histone H4 [Cryptococcus gattii VGII MMRL2647] KIR38982.1 histone H4 [Cryptococcus gattii VGII Ram5] KIR39838.1 histone H4 [Cryptococcus gattii VGII Ram5] KIR46358.1 histone H4 [Cryptococcus gattii CA1280] KIR48116.1 histone H4 [Cryptococcus gattii CA1280] KIR53912.1 histone H4 [Cryptococcus gattii Ru294] KIR55460.1 histone H4 [Cryptococcus gattii Ru294] KIR59558.1 histone H4 [Cryptococcus gattii CA1873] KIR69508.1 histone H4 [Cryptococcus gattii CA1873] KIR70612.1 histone H4 [Cryptococcus gattii VGII CA1014] KIR76009.1 histone H4 [Cryptococcus gattii VGII CA1014] KIR81049.1 histone H4 [Cryptococcus gattii EJB2] KIR82202.1 histone H4 [Cryptococcus gattii EJB2] KIR85196.1 histone H4 [Cryptococcus gattii VGIV IND107] KIR86998.1 histone H4 [Cryptococcus gattii VGIV IND107] KIR90808.1 histone H4 [Cryptococcus gattii VGII CBS 10090] KIR95952.1 histone H4 [Cryptococcus gattii VGII CBS 10090] KIR97451.1 histone H4 [Cryptococcus gattii VGII 2001/935-1] KIS02448.1 histone H4 [Cryptococcus gattii VGII 2001/935-1] KIY33393.1 histone H4 [Cryptococcus gattii E566] KIY34090.1 histone H4 [Cryptococcus gattii E566] KIY57874.1 histone H4 [Cryptococcus gattii VGII 99/473] KIY58895.1 histone H4 [Cryptococcus gattii VGII 99/473] KJE01623.1 histone H4 [Cryptococcus gattii NT-10] KJE03781.1 histone H4 [Cryptococcus gattii NT-10] OBR82355.1 histone H4 [Kwoniella dejecticola CBS 10117] OBR86838.1 histone H4 [Kwoniella dejecticola CBS 10117] OBR88313.1 histone H4 [Kwoniella dejecticola CBS 10117] OCF22368.1 histone H4 [Kwoniella bestiolae CBS 10118] OCF27128.1 histone H4 [Kwoniella bestiolae CBS 10118] OCF29272.1 histone H4 [Kwoniella bestiolae CBS 10118] OCF34120.1 histone H4 [Kwoniella heveanensis BCC8398] OCF34325.1 histone H4 [Kwoniella heveanensis BCC8398] OCF34880.1 histone H4 [Kwoniella heveanensis BCC8398] OCF40653.1 histone H4 [Kwoniella heveanensis CBS 569] OCF41017.1 histone H4 [Kwoniella heveanensis CBS 569] OCF44474.1 histone H4 [Kwoniella heveanensis CBS 569] OCF48040.1 histone H4 [Kwoniella pini CBS 10737] OCF50889.1 histone H4 [Kwoniella pini CBS 10737] OCF52814.1 histone H4 [Kwoniella pini CBS 10737] OCF57946.1 histone H4 [Kwoniella mangroviensis CBS 10435] OCF61866.1 histone H4 [Kwoniella mangroviensis CBS 10435] OCF67121.1 histone H4 [Kwoniella mangroviensis CBS 8507] OCF68276.1 histone H4 [Kwoniella mangroviensis CBS 8507] OCF69473.1 histone H4 [Kwoniella mangroviensis CBS 8507] OCF72318.1 histone H4 [Kwoniella mangroviensis CBS 8886] OCF74952.1 histone H4 [Kwoniella mangroviensis CBS 8886] OCF77884.1 histone H4 [Kwoniella mangroviensis CBS 8886] ODN76779.1 histone H4 [Cryptococcus amylolentus CBS 6039] ODN84929.1 histone H4 [Cryptococcus amylolentus CBS 6039] ODN97383.1 histone H4 [Tsuchiyaea wingfieldii CBS 7118] ODO04705.1 histone H4 [Cryptococcus amylolentus CBS 6273] ODO11371.1 histone H4 [Cryptococcus amylolentus CBS 6273] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >XP_007879582.1 hypothetical protein PFL1_03868 [Anthracocystis flocculosa PF-1] XP_011389079.1 putative histone H4 [Ustilago maydis 521] XP_014657300.1 histone H4 [Moesziomyces antarcticus] XP_016290462.1 histone H4 [Kalmanozyma brasiliensis GHG001] Q6ZXX3.4 RecName: Full=Histone H4 CBQ73108.1 probable HHF1-histone H4 [Sporisorium reilianum SRZ2] CCF52954.1 probable HHF1-histone H4 [Ustilago hordei] GAC71734.1 dehydrogenases with different specificities [Moesziomyces antarcticus T-34] EPQ28564.1 hypothetical protein PFL1_03868 [Anthracocystis flocculosa PF-1] EST05473.1 histone H4 [Kalmanozyma brasiliensis GHG001] ETS64718.1 histone h4 [Moesziomyces aphidis DSM 70725] GAK64360.1 histone H4 [Moesziomyces antarcticus] KIS69375.1 putative histone H4 [Ustilago maydis 521] CDR99138.1 hypothetical protein [Sporisorium scitamineum] CDU22677.1 probable HHF1-histone H4 [Sporisorium scitamineum] OAI99866.1 hypothetical protein A4X13_g7256 [Tilletia indica] OAJ09384.1 hypothetical protein A4X06_g7788 [Tilletia controversa] OAJ12342.1 hypothetical protein A4X03_g6766 [Tilletia caries] OAJ21788.1 hypothetical protein A4X09_g824 [Tilletia walkeri] OAJ26752.1 hypothetical protein A4X03_g522 [Tilletia caries] OAJ31890.1 hypothetical protein A4X06_g852 [Tilletia controversa] SAM82064.1 Histone H4 [Ustilago bromivora] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >XP_007000995.1 hypothetical protein TREMEDRAFT_42124 [Tremella mesenterica DSM 1558] XP_007002555.1 hypothetical protein TREMEDRAFT_42806 [Tremella mesenterica DSM 1558] XP_007007683.1 hypothetical protein TREMEDRAFT_74756 [Tremella mesenterica DSM 1558] EIW66610.1 hypothetical protein TREMEDRAFT_74756 [Tremella mesenterica DSM 1558] EIW71400.1 hypothetical protein TREMEDRAFT_42806 [Tremella mesenterica DSM 1558] EIW72970.1 hypothetical protein TREMEDRAFT_42124 [Tremella mesenterica DSM 1558] Length = 103 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >KNF02128.1 histone H4 [Puccinia striiformis f. sp. tritici PST-78] Length = 104 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 76 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 104 >XP_003307442.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] XP_003319687.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] XP_003325069.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] XP_003325129.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] XP_003325735.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] XP_003325739.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] XP_007403633.1 hypothetical protein MELLADRAFT_86934 [Melampsora larici-populina 98AG31] XP_007404030.1 hypothetical protein MELLADRAFT_86925 [Melampsora larici-populina 98AG31] XP_007407826.1 hypothetical protein MELLADRAFT_84431 [Melampsora larici-populina 98AG31] XP_007417077.1 histone H4 [Melampsora larici-populina 98AG31] XP_007418703.1 hypothetical protein MELLADRAFT_96223 [Melampsora larici-populina 98AG31] EFP74436.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP75268.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP80650.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP80710.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP81316.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP81320.1 histone H4 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EGF98007.1 hypothetical protein MELLADRAFT_96223 [Melampsora larici-populina 98AG31] EGF99652.1 histone H4 [Melampsora larici-populina 98AG31] EGG08852.1 hypothetical protein MELLADRAFT_84431 [Melampsora larici-populina 98AG31] EGG12695.1 hypothetical protein MELLADRAFT_86934 [Melampsora larici-populina 98AG31] EGG13092.1 hypothetical protein MELLADRAFT_86925 [Melampsora larici-populina 98AG31] KNE88514.1 histone H4 [Puccinia striiformis f. sp. tritici PST-78] KNE95443.1 histone H4 [Puccinia striiformis f. sp. tritici PST-78] KNE97099.1 histone H4 [Puccinia striiformis f. sp. tritici PST-78] KNE97769.1 histone H4 [Puccinia striiformis f. sp. tritici PST-78] KNF05480.1 histone H4 [Puccinia striiformis f. sp. tritici PST-78] KNZ46878.1 histone H4 [Puccinia sorghi] KNZ60674.1 histone H4 [Puccinia sorghi] KNZ60819.1 histone H4 [Puccinia sorghi] KNZ64715.1 histone H4 [Puccinia sorghi] OAV87988.1 histone H4 [Puccinia triticina 1-1 BBBD Race 1] OAV88974.1 histone H4 [Puccinia triticina 1-1 BBBD Race 1] OAV93681.1 histone H4 [Puccinia triticina 1-1 BBBD Race 1] OAV94554.1 histone H4 [Puccinia triticina 1-1 BBBD Race 1] OAV94557.1 histone H4 [Puccinia triticina 1-1 BBBD Race 1] OAV95847.1 histone H4 [Puccinia triticina 1-1 BBBD Race 1] Length = 104 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 76 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 104 >XP_013240198.1 hypothetical protein K437DRAFT_229481, partial [Tilletiaria anomala UBC 951] KDN36887.1 hypothetical protein K437DRAFT_229481, partial [Tilletiaria anomala UBC 951] Length = 49 Score = 59.7 bits (143), Expect = 3e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFG 84 EHAKRKTVTSLDVVYALKRQGRTLYGFG Sbjct: 21 EHAKRKTVTSLDVVYALKRQGRTLYGFG 48 >XP_018286973.1 hypothetical protein PHYBLDRAFT_188516 [Phycomyces blakesleeanus NRRL 1555(-)] OAD68933.1 hypothetical protein PHYBLDRAFT_188516 [Phycomyces blakesleeanus NRRL 1555(-)] Length = 108 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 103 >XP_013242893.1 hypothetical protein K437DRAFT_224727, partial [Tilletiaria anomala UBC 951] KDN44719.1 hypothetical protein K437DRAFT_224727, partial [Tilletiaria anomala UBC 951] Length = 56 Score = 59.7 bits (143), Expect = 4e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFG 84 EHAKRKTVTSLDVVYALKRQGRTLYGFG Sbjct: 28 EHAKRKTVTSLDVVYALKRQGRTLYGFG 55 >KNZ63047.1 histone H4 [Puccinia sorghi] Length = 114 Score = 61.2 bits (147), Expect = 4e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDVVYALKRQGRTLYGFGA Sbjct: 86 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 114 >XP_018738976.1 uncharacterized protein MSY001_0340 [Malassezia sympodialis ATCC 42132] CCU97634.1 unnamed protein product [Malassezia sympodialis ATCC 42132] SHO78035.1 Histone H4 [Malassezia sympodialis ATCC 42132] Length = 103 Score = 60.8 bits (146), Expect = 4e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDV+YALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVIYALKRQGRTLYGFGA 103 >XP_001729476.1 hypothetical protein MGL_3511 [Malassezia globosa CBS 7966] XP_017991291.1 hypothetical protein Malapachy_1925 [Malassezia pachydermatis] XP_018741485.1 uncharacterized protein MSY001_2985 [Malassezia sympodialis ATCC 42132] EDP42262.1 hypothetical protein MGL_3511 [Malassezia globosa CBS 7966] CCV00280.1 unnamed protein product [Malassezia sympodialis ATCC 42132] KOS13659.1 hypothetical protein Malapachy_1925 [Malassezia pachydermatis] SHO78905.1 Similar to S.cerevisiae protein HHF2 (Histone H4) [Malassezia sympodialis ATCC 42132] Length = 103 Score = 60.8 bits (146), Expect = 4e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA 87 EHAKRKTVTSLDV+YALKRQGRTLYGFGA Sbjct: 75 EHAKRKTVTSLDVIYALKRQGRTLYGFGA 103 >KVI04940.1 Histone core [Cynara cardunculus var. scolymus] Length = 197 Score = 62.8 bits (151), Expect = 5e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 1 EHAKRKTVTSLDVVYALKRQGRTLYGFGA*FPFLYPYWSSCLT 129 EHA+RKTVT++DVVYALKRQGRTLYGFGA F F P+ S T Sbjct: 75 EHARRKTVTAMDVVYALKRQGRTLYGFGAIFYFSSPFKLSSKT 117