BLASTX nr result
ID: Phellodendron21_contig00016322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016322 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN63104.1 hypothetical protein VITISV_038369, partial [Vitis vi... 88 5e-20 ONI35609.1 hypothetical protein PRUPE_1G545600 [Prunus persica] ... 88 5e-20 XP_010091561.1 40S ribosomal protein S28 [Morus notabilis] XP_01... 88 5e-20 XP_011627494.1 PREDICTED: 40S ribosomal protein S28 [Amborella t... 88 5e-20 XP_002281508.3 PREDICTED: 40S ribosomal protein S28 [Vitis vinif... 88 5e-20 XP_008241134.1 PREDICTED: 40S ribosomal protein S28-like [Prunus... 88 5e-20 XP_002281530.1 PREDICTED: 40S ribosomal protein S28 [Vitis vinif... 88 5e-20 XP_006481678.1 PREDICTED: 40S ribosomal protein S28 [Citrus sine... 88 5e-20 XP_007202837.1 hypothetical protein PRUPE_ppa014541mg [Prunus pe... 88 5e-20 OAY43366.1 hypothetical protein MANES_08G064300 [Manihot esculenta] 87 7e-20 OAY43067.1 hypothetical protein MANES_08G039300 [Manihot esculenta] 87 7e-20 OAY43066.1 hypothetical protein MANES_08G039200 [Manihot esculenta] 87 7e-20 XP_016543923.1 PREDICTED: 40S ribosomal protein S28-like [Capsic... 87 7e-20 XP_012466960.1 PREDICTED: 40S ribosomal protein S28 [Gossypium r... 87 7e-20 XP_008391409.1 PREDICTED: 40S ribosomal protein S28 [Malus domes... 87 7e-20 XP_002520788.1 PREDICTED: 40S ribosomal protein S28-2 [Ricinus c... 87 7e-20 AAR83864.1 28 kDa small subunit ribosomal protein [Capsicum annuum] 87 7e-20 KVI09230.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var... 87 9e-20 KJB27706.1 hypothetical protein B456_005G005700 [Gossypium raimo... 87 9e-20 XP_010093316.1 40S ribosomal protein S28 [Morus notabilis] EXB53... 88 9e-20 >CAN63104.1 hypothetical protein VITISV_038369, partial [Vitis vinifera] Length = 62 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 6 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 48 >ONI35609.1 hypothetical protein PRUPE_1G545600 [Prunus persica] ONI35610.1 hypothetical protein PRUPE_1G545600 [Prunus persica] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_010091561.1 40S ribosomal protein S28 [Morus notabilis] XP_015875043.1 PREDICTED: 40S ribosomal protein S28 [Ziziphus jujuba] XP_015889831.1 PREDICTED: 40S ribosomal protein S28 [Ziziphus jujuba] XP_018848846.1 PREDICTED: 40S ribosomal protein S28 [Juglans regia] XP_018848847.1 PREDICTED: 40S ribosomal protein S28 [Juglans regia] XP_018851119.1 PREDICTED: 40S ribosomal protein S28 [Juglans regia] XP_018851120.1 PREDICTED: 40S ribosomal protein S28 [Juglans regia] XP_018858314.1 PREDICTED: 40S ribosomal protein S28 [Juglans regia] EXC37044.1 40S ribosomal protein S28 [Morus notabilis] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_011627494.1 PREDICTED: 40S ribosomal protein S28 [Amborella trichopoda] XP_011627495.1 PREDICTED: 40S ribosomal protein S28 [Amborella trichopoda] XP_011626505.1 PREDICTED: 40S ribosomal protein S28 [Amborella trichopoda] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_002281508.3 PREDICTED: 40S ribosomal protein S28 [Vitis vinifera] XP_010653847.1 PREDICTED: 40S ribosomal protein S28 [Vitis vinifera] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_008241134.1 PREDICTED: 40S ribosomal protein S28-like [Prunus mume] XP_016651751.1 PREDICTED: 40S ribosomal protein S28-like [Prunus mume] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_002281530.1 PREDICTED: 40S ribosomal protein S28 [Vitis vinifera] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_006481678.1 PREDICTED: 40S ribosomal protein S28 [Citrus sinensis] KDO70779.1 hypothetical protein CISIN_1g035463mg [Citrus sinensis] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_007202837.1 hypothetical protein PRUPE_ppa014541mg [Prunus persica] XP_008225488.1 PREDICTED: 40S ribosomal protein S28 [Prunus mume] XP_008241138.1 PREDICTED: 40S ribosomal protein S28 [Prunus mume] CAA10101.1 ribosomal protein S28 [Prunus persica] CAA10102.1 ribosomal protein S28 [Prunus persica] CAA10103.1 ribosomal protein S28 [Prunus persica] ONH95713.1 hypothetical protein PRUPE_7G086800 [Prunus persica] ONI10993.1 hypothetical protein PRUPE_4G080900 [Prunus persica] Length = 65 Score = 87.8 bits (216), Expect = 5e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >OAY43366.1 hypothetical protein MANES_08G064300 [Manihot esculenta] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGD+ Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDV 51 >OAY43067.1 hypothetical protein MANES_08G039300 [Manihot esculenta] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGD+ Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDV 51 >OAY43066.1 hypothetical protein MANES_08G039200 [Manihot esculenta] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGD+ Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDV 51 >XP_016543923.1 PREDICTED: 40S ribosomal protein S28-like [Capsicum annuum] XP_016543924.1 PREDICTED: 40S ribosomal protein S28-like [Capsicum annuum] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVK+MGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKIMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_012466960.1 PREDICTED: 40S ribosomal protein S28 [Gossypium raimondii] XP_012466961.1 PREDICTED: 40S ribosomal protein S28 [Gossypium raimondii] XP_012481370.1 PREDICTED: 40S ribosomal protein S28 [Gossypium raimondii] XP_012485676.1 PREDICTED: 40S ribosomal protein S28 [Gossypium raimondii] XP_012485677.1 PREDICTED: 40S ribosomal protein S28 [Gossypium raimondii] XP_016724083.1 PREDICTED: 40S ribosomal protein S28 [Gossypium hirsutum] XP_016669393.1 PREDICTED: 40S ribosomal protein S28 [Gossypium hirsutum] XP_016669394.1 PREDICTED: 40S ribosomal protein S28 [Gossypium hirsutum] XP_016680375.1 PREDICTED: 40S ribosomal protein S28 [Gossypium hirsutum] XP_016685174.1 PREDICTED: 40S ribosomal protein S28 [Gossypium hirsutum] XP_016706208.1 PREDICTED: 40S ribosomal protein S28 [Gossypium hirsutum] XP_017608860.1 PREDICTED: 40S ribosomal protein S28 [Gossypium arboreum] XP_017608861.1 PREDICTED: 40S ribosomal protein S28 [Gossypium arboreum] XP_017618611.1 PREDICTED: 40S ribosomal protein S28 [Gossypium arboreum] XP_017632313.1 PREDICTED: 40S ribosomal protein S28 [Gossypium arboreum] KHG00692.1 40S ribosomal S28 [Gossypium arboreum] KHG03308.1 40S ribosomal S28 [Gossypium arboreum] KJB27705.1 hypothetical protein B456_005G005700 [Gossypium raimondii] KJB27707.1 hypothetical protein B456_005G005700 [Gossypium raimondii] KJB36192.1 hypothetical protein B456_006G145900 [Gossypium raimondii] KJB36193.1 hypothetical protein B456_006G145900 [Gossypium raimondii] KJB36194.1 hypothetical protein B456_006G145900 [Gossypium raimondii] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVK+MGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKIMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_008391409.1 PREDICTED: 40S ribosomal protein S28 [Malus domestica] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VV+KVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVIKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >XP_002520788.1 PREDICTED: 40S ribosomal protein S28-2 [Ricinus communis] XP_002531592.1 PREDICTED: 40S ribosomal protein S28-2 [Ricinus communis] XP_012065870.1 PREDICTED: 40S ribosomal protein S28-2 [Jatropha curcas] XP_012090863.1 PREDICTED: 40S ribosomal protein S28-2 [Jatropha curcas] EEF30795.1 ribosomal protein S28, putative [Ricinus communis] EEF41497.1 ribosomal protein S28, putative [Ricinus communis] ADR71253.1 40S ribosomal protein S28A [Hevea brasiliensis] ADR71254.1 40S ribosomal protein S28B [Hevea brasiliensis] KDP21914.1 hypothetical protein JCGZ_03052 [Jatropha curcas] KDP43201.1 hypothetical protein JCGZ_22753 [Jatropha curcas] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGD+ Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDV 51 >AAR83864.1 28 kDa small subunit ribosomal protein [Capsicum annuum] Length = 65 Score = 87.4 bits (215), Expect = 7e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVK+MGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 9 VVVKIMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >KVI09230.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var. scolymus] Length = 72 Score = 87.4 bits (215), Expect = 9e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGD+ Sbjct: 9 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDV 51 >KJB27706.1 hypothetical protein B456_005G005700 [Gossypium raimondii] Length = 73 Score = 87.4 bits (215), Expect = 9e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVK+MGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 17 VVVKIMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 59 >XP_010093316.1 40S ribosomal protein S28 [Morus notabilis] EXB53855.1 40S ribosomal protein S28 [Morus notabilis] Length = 86 Score = 87.8 bits (216), Expect = 9e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 504 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 376 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI Sbjct: 30 VVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 72