BLASTX nr result
ID: Phellodendron21_contig00016310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016310 (551 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO66055.1 hypothetical protein CISIN_1g013977mg [Citrus sinensi... 95 1e-19 XP_006443503.1 hypothetical protein CICLE_v10020229mg [Citrus cl... 94 4e-19 XP_018498474.1 PREDICTED: microfibrillar-associated protein 1-li... 92 1e-18 XP_008227035.1 PREDICTED: microfibrillar-associated protein 1-li... 92 1e-18 XP_007211722.1 hypothetical protein PRUPE_ppa005985mg [Prunus pe... 92 1e-18 XP_010275284.1 PREDICTED: microfibrillar-associated protein 1-li... 92 1e-18 XP_008231592.1 PREDICTED: microfibrillar-associated protein 1-li... 92 1e-18 XP_008442034.1 PREDICTED: microfibrillar-associated protein 1 [C... 92 1e-18 XP_010034024.1 PREDICTED: microfibrillar-associated protein 1 [E... 92 1e-18 XP_011653945.1 PREDICTED: microfibrillar-associated protein 1 [C... 92 1e-18 CBI17794.3 unnamed protein product, partial [Vitis vinifera] 91 2e-18 XP_008361533.1 PREDICTED: microfibrillar-associated protein 1-li... 92 2e-18 OIW21673.1 hypothetical protein TanjilG_07818 [Lupinus angustifo... 91 2e-18 XP_010260413.1 PREDICTED: microfibrillar-associated protein 1-li... 91 3e-18 XP_017242413.1 PREDICTED: microfibrillar-associated protein 1-li... 91 4e-18 XP_002275399.1 PREDICTED: microfibrillar-associated protein 1 [V... 91 4e-18 XP_018840169.1 PREDICTED: microfibrillar-associated protein 1-li... 91 5e-18 XP_010056419.1 PREDICTED: microfibrillar-associated protein 1 [E... 91 5e-18 XP_019433591.1 PREDICTED: microfibrillar-associated protein 1-li... 91 5e-18 XP_011004779.1 PREDICTED: microfibrillar-associated protein 1-li... 91 5e-18 >KDO66055.1 hypothetical protein CISIN_1g013977mg [Citrus sinensis] KDO66056.1 hypothetical protein CISIN_1g013977mg [Citrus sinensis] Length = 432 Score = 95.1 bits (235), Expect = 1e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR Sbjct: 392 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 432 >XP_006443503.1 hypothetical protein CICLE_v10020229mg [Citrus clementina] XP_006479180.1 PREDICTED: microfibrillar-associated protein 1-like [Citrus sinensis] ESR56743.1 hypothetical protein CICLE_v10020229mg [Citrus clementina] Length = 432 Score = 93.6 bits (231), Expect = 4e-19 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNAPIAKP+GSKKLKDWETR Sbjct: 392 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPQGSKKLKDWETR 432 >XP_018498474.1 PREDICTED: microfibrillar-associated protein 1-like [Pyrus x bretschneideri] Length = 428 Score = 92.4 bits (228), Expect = 1e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNAPI+KPKGSKKLKDWE+R Sbjct: 388 WNNPWTYNDPLRAKYNAKMAGMNAPISKPKGSKKLKDWESR 428 >XP_008227035.1 PREDICTED: microfibrillar-associated protein 1-like [Prunus mume] Length = 433 Score = 92.4 bits (228), Expect = 1e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLR+KYNAKMAGMNAPIAKPKGSKKLKDWE+R Sbjct: 393 WNNPWTYNDPLRSKYNAKMAGMNAPIAKPKGSKKLKDWESR 433 >XP_007211722.1 hypothetical protein PRUPE_ppa005985mg [Prunus persica] ONI13508.1 hypothetical protein PRUPE_4G226700 [Prunus persica] Length = 433 Score = 92.4 bits (228), Expect = 1e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLR+KYNAKMAGMNAPIAKPKGSKKLKDWE+R Sbjct: 393 WNNPWTYNDPLRSKYNAKMAGMNAPIAKPKGSKKLKDWESR 433 >XP_010275284.1 PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] Length = 434 Score = 92.4 bits (228), Expect = 1e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWE R Sbjct: 394 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWEGR 434 >XP_008231592.1 PREDICTED: microfibrillar-associated protein 1-like isoform X1 [Prunus mume] XP_016651072.1 PREDICTED: microfibrillar-associated protein 1-like isoform X1 [Prunus mume] XP_016651073.1 PREDICTED: microfibrillar-associated protein 1-like isoform X2 [Prunus mume] Length = 432 Score = 92.0 bits (227), Expect = 1e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMN PIAKPKGSKKLKDWE+R Sbjct: 392 WNNPWTYNDPLRAKYNAKMAGMNTPIAKPKGSKKLKDWESR 432 >XP_008442034.1 PREDICTED: microfibrillar-associated protein 1 [Cucumis melo] XP_008442035.1 PREDICTED: microfibrillar-associated protein 1 [Cucumis melo] Length = 433 Score = 92.0 bits (227), Expect = 1e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNAPI KPKGSKKLKDWE+R Sbjct: 393 WNNPWTYNDPLRAKYNAKMAGMNAPITKPKGSKKLKDWESR 433 >XP_010034024.1 PREDICTED: microfibrillar-associated protein 1 [Eucalyptus grandis] XP_010034025.1 PREDICTED: microfibrillar-associated protein 1 [Eucalyptus grandis] XP_010034026.1 PREDICTED: microfibrillar-associated protein 1 [Eucalyptus grandis] XP_018719996.1 PREDICTED: microfibrillar-associated protein 1 [Eucalyptus grandis] KCW53900.1 hypothetical protein EUGRSUZ_J03113 [Eucalyptus grandis] Length = 433 Score = 92.0 bits (227), Expect = 1e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKM GMNAPIAKPKGSKKLKDWE+R Sbjct: 393 WNNPWTYNDPLRAKYNAKMGGMNAPIAKPKGSKKLKDWESR 433 >XP_011653945.1 PREDICTED: microfibrillar-associated protein 1 [Cucumis sativus] KGN54899.1 hypothetical protein Csa_4G578870 [Cucumis sativus] Length = 433 Score = 92.0 bits (227), Expect = 1e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNAPI KPKGSKKLKDWE+R Sbjct: 393 WNNPWTYNDPLRAKYNAKMAGMNAPITKPKGSKKLKDWESR 433 >CBI17794.3 unnamed protein product, partial [Vitis vinifera] Length = 345 Score = 90.9 bits (224), Expect = 2e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMN PIAKPKGSKKLKDW++R Sbjct: 305 WNNPWTYNDPLRAKYNAKMAGMNVPIAKPKGSKKLKDWDSR 345 >XP_008361533.1 PREDICTED: microfibrillar-associated protein 1-like [Malus domestica] XP_017185025.1 PREDICTED: microfibrillar-associated protein 1-like [Malus domestica] Length = 428 Score = 91.7 bits (226), Expect = 2e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNAPI+KPKGSKKLKDWE R Sbjct: 388 WNNPWTYNDPLRAKYNAKMAGMNAPISKPKGSKKLKDWECR 428 >OIW21673.1 hypothetical protein TanjilG_07818 [Lupinus angustifolius] Length = 327 Score = 90.5 bits (223), Expect = 2e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYN KMA MNAPIAKPKGSKKLKDWETR Sbjct: 287 WNNPWTYNDPLRAKYNDKMAAMNAPIAKPKGSKKLKDWETR 327 >XP_010260413.1 PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] XP_010260414.1 PREDICTED: microfibrillar-associated protein 1-like [Nelumbo nucifera] Length = 428 Score = 91.3 bits (225), Expect = 3e-18 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWE 435 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWE Sbjct: 388 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWE 426 >XP_017242413.1 PREDICTED: microfibrillar-associated protein 1-like [Daucus carota subsp. sativus] KZN11689.1 hypothetical protein DCAR_004345 [Daucus carota subsp. sativus] Length = 433 Score = 90.9 bits (224), Expect = 4e-18 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGM+APIAKPKGSKK+KDWE+R Sbjct: 393 WNNPWTYNDPLRAKYNAKMAGMDAPIAKPKGSKKIKDWESR 433 >XP_002275399.1 PREDICTED: microfibrillar-associated protein 1 [Vitis vinifera] Length = 436 Score = 90.9 bits (224), Expect = 4e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMN PIAKPKGSKKLKDW++R Sbjct: 396 WNNPWTYNDPLRAKYNAKMAGMNVPIAKPKGSKKLKDWDSR 436 >XP_018840169.1 PREDICTED: microfibrillar-associated protein 1-like [Juglans regia] XP_018840170.1 PREDICTED: microfibrillar-associated protein 1-like [Juglans regia] Length = 432 Score = 90.5 bits (223), Expect = 5e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNA IAKPKGSKKLKDWE+R Sbjct: 392 WNNPWTYNDPLRAKYNAKMAGMNAAIAKPKGSKKLKDWESR 432 >XP_010056419.1 PREDICTED: microfibrillar-associated protein 1 [Eucalyptus grandis] XP_010056421.1 PREDICTED: microfibrillar-associated protein 1 [Eucalyptus grandis] KCW73144.1 hypothetical protein EUGRSUZ_E01598 [Eucalyptus grandis] Length = 433 Score = 90.5 bits (223), Expect = 5e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAG+NAPI KPKGSKKLKDWE+R Sbjct: 393 WNNPWTYNDPLRAKYNAKMAGLNAPIEKPKGSKKLKDWESR 433 >XP_019433591.1 PREDICTED: microfibrillar-associated protein 1-like [Lupinus angustifolius] XP_019433593.1 PREDICTED: microfibrillar-associated protein 1-like [Lupinus angustifolius] XP_019433594.1 PREDICTED: microfibrillar-associated protein 1-like [Lupinus angustifolius] XP_019433595.1 PREDICTED: microfibrillar-associated protein 1-like [Lupinus angustifolius] OIW21672.1 hypothetical protein TanjilG_07817 [Lupinus angustifolius] Length = 435 Score = 90.5 bits (223), Expect = 5e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYN KMA MNAPIAKPKGSKKLKDWETR Sbjct: 395 WNNPWTYNDPLRAKYNDKMAAMNAPIAKPKGSKKLKDWETR 435 >XP_011004779.1 PREDICTED: microfibrillar-associated protein 1-like [Populus euphratica] XP_011004780.1 PREDICTED: microfibrillar-associated protein 1-like [Populus euphratica] XP_011004781.1 PREDICTED: microfibrillar-associated protein 1-like [Populus euphratica] XP_011004782.1 PREDICTED: microfibrillar-associated protein 1-like [Populus euphratica] Length = 436 Score = 90.5 bits (223), Expect = 5e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 551 WNNPWTYNDPLRAKYNAKMAGMNAPIAKPKGSKKLKDWETR 429 WNNPWTYNDPLRAKYNAKMAGMNA IAKPKGSKKLKDWE+R Sbjct: 396 WNNPWTYNDPLRAKYNAKMAGMNAAIAKPKGSKKLKDWESR 436