BLASTX nr result
ID: Phellodendron21_contig00016234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016234 (1018 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO66764.1 hypothetical protein CISIN_1g016540mg [Citrus sinensis] 82 7e-14 >KDO66764.1 hypothetical protein CISIN_1g016540mg [Citrus sinensis] Length = 387 Score = 82.4 bits (202), Expect = 7e-14 Identities = 49/84 (58%), Positives = 52/84 (61%), Gaps = 4/84 (4%) Frame = +2 Query: 446 FLEVLHHHKG----GAIHIV*APNEGLAQGGVIPSTFLQGQGARGGAILGVYPQELGRVS 613 F EVLH H+G GAIH+V APN GL Q ARGGA L VYPQ LGRV Sbjct: 290 FPEVLHRHEGEALGGAIHVVLAPNGGLTQE------------ARGGATLRVYPQGLGRVF 337 Query: 614 PAGGHPSGESPTRVTLGAQVQVLD 685 P GGHPSG + TLGAQVQVLD Sbjct: 338 PVGGHPSGVTLEGATLGAQVQVLD 361