BLASTX nr result
ID: Phellodendron21_contig00016226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016226 (582 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413536.1 hypothetical protein MELLADRAFT_109525 [Melampsor... 52 9e-06 >XP_007413536.1 hypothetical protein MELLADRAFT_109525 [Melampsora larici-populina 98AG31] EGG03076.1 hypothetical protein MELLADRAFT_109525 [Melampsora larici-populina 98AG31] Length = 100 Score = 52.4 bits (124), Expect = 9e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 404 RTYSDNSGATAQSKEFSQRERSEELRYIRDKDTAD 300 RTYSD+ GATA SK+F+Q+ERSEE RY+R K+ D Sbjct: 27 RTYSDHPGATANSKDFAQKERSEETRYMRQKEAED 61