BLASTX nr result
ID: Phellodendron21_contig00016050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00016050 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO37279.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] 78 4e-16 KDO37278.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] 78 6e-16 KDO37277.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] 78 8e-16 XP_006438856.1 hypothetical protein CICLE_v10033025mg [Citrus cl... 77 9e-16 KDO37276.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] 78 9e-16 XP_006438855.1 hypothetical protein CICLE_v10033025mg [Citrus cl... 77 1e-15 XP_006438854.1 hypothetical protein CICLE_v10033025mg [Citrus cl... 77 2e-15 XP_006483012.1 PREDICTED: acyl carrier protein 1, chloroplastic ... 77 3e-15 XP_010066441.1 PREDICTED: acyl carrier protein 4, chloroplastic ... 61 3e-09 KCW64328.1 hypothetical protein EUGRSUZ_G01960 [Eucalyptus grand... 56 2e-07 XP_002267614.1 PREDICTED: acyl carrier protein 1, chloroplastic ... 56 2e-07 XP_010250559.1 PREDICTED: acyl carrier protein 1, chloroplastic-... 53 4e-06 >KDO37279.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] Length = 112 Score = 77.8 bits (190), Expect = 4e-16 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 +KPSLSNNVIAERT NLKM GWR+N FPSLK+N F VSCSAKPET Sbjct: 16 LKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPET 62 >KDO37278.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] Length = 121 Score = 77.8 bits (190), Expect = 6e-16 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 +KPSLSNNVIAERT NLKM GWR+N FPSLK+N F VSCSAKPET Sbjct: 16 LKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPET 62 >KDO37277.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] Length = 135 Score = 77.8 bits (190), Expect = 8e-16 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 +KPSLSNNVIAERT NLKM GWR+N FPSLK+N F VSCSAKPET Sbjct: 16 LKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPET 62 >XP_006438856.1 hypothetical protein CICLE_v10033025mg [Citrus clementina] ESR52096.1 hypothetical protein CICLE_v10033025mg [Citrus clementina] Length = 112 Score = 77.0 bits (188), Expect = 9e-16 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 ++PS SNNVIAERT NLKM GWR+NSFPSLK+N F VSCSAKPET Sbjct: 16 LEPSFSNNVIAERTTNLKMAIGGWRKNSFPSLKTNRFCVSCSAKPET 62 >KDO37276.1 hypothetical protein CISIN_1g032464mg [Citrus sinensis] Length = 140 Score = 77.8 bits (190), Expect = 9e-16 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 +KPSLSNNVIAERT NLKM GWR+N FPSLK+N F VSCSAKPET Sbjct: 16 LKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPET 62 >XP_006438855.1 hypothetical protein CICLE_v10033025mg [Citrus clementina] ESR52095.1 hypothetical protein CICLE_v10033025mg [Citrus clementina] Length = 121 Score = 77.0 bits (188), Expect = 1e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 ++PS SNNVIAERT NLKM GWR+NSFPSLK+N F VSCSAKPET Sbjct: 16 LEPSFSNNVIAERTTNLKMAIGGWRKNSFPSLKTNRFCVSCSAKPET 62 >XP_006438854.1 hypothetical protein CICLE_v10033025mg [Citrus clementina] ESR52094.1 hypothetical protein CICLE_v10033025mg [Citrus clementina] Length = 140 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 ++PS SNNVIAERT NLKM GWR+NSFPSLK+N F VSCSAKPET Sbjct: 16 LEPSFSNNVIAERTTNLKMAIGGWRKNSFPSLKTNRFCVSCSAKPET 62 >XP_006483012.1 PREDICTED: acyl carrier protein 1, chloroplastic [Citrus sinensis] KDO83164.1 hypothetical protein CISIN_1g032446mg [Citrus sinensis] Length = 140 Score = 76.6 bits (187), Expect = 3e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 ++PS SNNVIAERT NLKM GWR+NSFPSLK+N F VSCSAKPET Sbjct: 16 LEPSFSNNVIAERTSNLKMAIGGWRKNSFPSLKTNRFCVSCSAKPET 62 >XP_010066441.1 PREDICTED: acyl carrier protein 4, chloroplastic [Eucalyptus grandis] KCW64330.1 hypothetical protein EUGRSUZ_G01960 [Eucalyptus grandis] Length = 136 Score = 60.8 bits (146), Expect = 3e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 140 KPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 KPSL +N T +LK+V++GWR+N FPSL+S+ FRVSC+AKPET Sbjct: 16 KPSLKSN----ETSSLKVVSLGWRKNGFPSLRSSRFRVSCAAKPET 57 >KCW64328.1 hypothetical protein EUGRSUZ_G01960 [Eucalyptus grandis] KCW64329.1 hypothetical protein EUGRSUZ_G01960 [Eucalyptus grandis] Length = 137 Score = 56.2 bits (134), Expect = 2e-07 Identities = 28/47 (59%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -2 Query: 140 KPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCS-AKPET 3 KPSL +N T +LK+V++GWR+N FPSL+S+ FRVSC+ AKPET Sbjct: 16 KPSLKSN----ETSSLKVVSLGWRKNGFPSLRSSRFRVSCAQAKPET 58 >XP_002267614.1 PREDICTED: acyl carrier protein 1, chloroplastic [Vitis vinifera] CBI35660.3 unnamed protein product, partial [Vitis vinifera] Length = 139 Score = 56.2 bits (134), Expect = 2e-07 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -2 Query: 131 LSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 L + I + +LKMVT+GW ++ FPSL+++ FRVSCSAKPET Sbjct: 18 LKSRQITGKASSLKMVTVGWTKSGFPSLRTSRFRVSCSAKPET 60 >XP_010250559.1 PREDICTED: acyl carrier protein 1, chloroplastic-like [Nelumbo nucifera] Length = 140 Score = 52.8 bits (125), Expect = 4e-06 Identities = 22/47 (46%), Positives = 34/47 (72%) Frame = -2 Query: 143 MKPSLSNNVIAERTLNLKMVTIGWRRNSFPSLKSNHFRVSCSAKPET 3 +K S+ + + RT L++V++ W +N FPSL+S+ FRV C+AKPET Sbjct: 15 LKHSVGDYKLTGRTSTLRLVSMNWTKNGFPSLRSSRFRVCCAAKPET 61