BLASTX nr result
ID: Phellodendron21_contig00015875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00015875 (525 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO45752.1 hypothetical protein CISIN_1g020391mg [Citrus sinensi... 97 6e-21 XP_006426778.1 hypothetical protein CICLE_v10025816mg [Citrus cl... 97 1e-20 XP_006465817.1 PREDICTED: ethylene-responsive transcription fact... 97 1e-20 XP_006426779.1 hypothetical protein CICLE_v10025816mg [Citrus cl... 97 1e-20 KDO45751.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] 95 3e-20 ADJ67434.1 ethylene response factor 5 [Actinidia deliciosa] 85 3e-16 XP_015902357.1 PREDICTED: ethylene-responsive transcription fact... 85 3e-16 XP_009605490.1 PREDICTED: ethylene-responsive transcription fact... 84 4e-16 XP_016510932.1 PREDICTED: ethylene-responsive transcription fact... 84 6e-16 XP_009794756.1 PREDICTED: ethylene-responsive transcription fact... 84 6e-16 AFV09846.1 ethylene-responsive transcription factor, partial [Mo... 77 7e-16 CBI35806.3 unnamed protein product, partial [Vitis vinifera] 79 8e-16 XP_014513131.1 PREDICTED: ethylene-responsive transcription fact... 78 8e-16 AAX84670.1 ethylene response factor [Manihot esculenta] OAY53269... 83 2e-15 XP_008380747.1 PREDICTED: ethylene-responsive transcription fact... 83 2e-15 NP_001280975.1 ethylene-responsive transcription factor RAP2-12-... 83 2e-15 ACU19044.1 unknown [Glycine max] 77 3e-15 XP_007024747.1 PREDICTED: ethylene-responsive transcription fact... 82 3e-15 XP_012856557.1 PREDICTED: ethylene-responsive transcription fact... 82 4e-15 XP_009357901.1 PREDICTED: ethylene-responsive transcription fact... 82 4e-15 >KDO45752.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] KDO45753.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] KDO45754.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] Length = 326 Score = 97.1 bits (240), Expect = 6e-21 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFL MPY +GSW+ASLDAFLNGDNTQDGGN MNLWSFDDFPSTLGGVY Sbjct: 279 KFLPMPYPEGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 326 >XP_006426778.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] XP_006426782.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40018.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40022.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] Length = 386 Score = 97.1 bits (240), Expect = 1e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFL MPY +GSW+ASLDAFLNGDNTQDGGN MNLWSFDDFPSTLGGVY Sbjct: 339 KFLPMPYPEGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 386 >XP_006465817.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X2 [Citrus sinensis] XP_006465818.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X1 [Citrus sinensis] XP_006465819.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X3 [Citrus sinensis] XP_015387739.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 isoform X1 [Citrus sinensis] Length = 389 Score = 97.1 bits (240), Expect = 1e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFL MPY +GSW+ASLDAFLNGDNTQDGGN MNLWSFDDFPSTLGGVY Sbjct: 342 KFLPMPYPEGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 389 >XP_006426779.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] XP_006426780.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] XP_006426781.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40019.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40020.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] ESR40021.1 hypothetical protein CICLE_v10025816mg [Citrus clementina] Length = 389 Score = 97.1 bits (240), Expect = 1e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFL MPY +GSW+ASLDAFLNGDNTQDGGN MNLWSFDDFPSTLGGVY Sbjct: 342 KFLPMPYPEGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 389 >KDO45751.1 hypothetical protein CISIN_1g020391mg [Citrus sinensis] Length = 319 Score = 95.1 bits (235), Expect = 3e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 521 FLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 FL MPY +GSW+ASLDAFLNGDNTQDGGN MNLWSFDDFPSTLGGVY Sbjct: 273 FLPMPYPEGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGGVY 319 >ADJ67434.1 ethylene response factor 5 [Actinidia deliciosa] Length = 382 Score = 84.7 bits (208), Expect = 3e-16 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGV 384 KF Q+PYL+ +WDAS+D FLNGD TQDGG+SMNLW+FDDFPS +GGV Sbjct: 336 KFFQIPYLEANWDASVDTFLNGDATQDGGSSMNLWTFDDFPSMMGGV 382 >XP_015902357.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Ziziphus jujuba] XP_015902366.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Ziziphus jujuba] Length = 384 Score = 84.7 bits (208), Expect = 3e-16 Identities = 38/49 (77%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -2 Query: 524 KFLQMPYLDGS-WDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFLQMPYL+GS WDAS+DAFLNGD TQDGGN ++LWSFDDFPS +G V+ Sbjct: 336 KFLQMPYLEGSNWDASMDAFLNGDATQDGGNPVDLWSFDDFPSMVGAVF 384 >XP_009605490.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Nicotiana tomentosiformis] XP_016515225.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Nicotiana tabacum] Length = 375 Score = 84.3 bits (207), Expect = 4e-16 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFLQ+PYL+G+WDAS+DA LN D TQDGGN+M+LWSF+D PS +GGVY Sbjct: 328 KFLQIPYLEGNWDASVDALLNADATQDGGNAMDLWSFEDIPSLMGGVY 375 >XP_016510932.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Nicotiana tabacum] Length = 375 Score = 84.0 bits (206), Expect = 6e-16 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFLQ+PYL+G+WDAS++A LN D TQDGGN+M+LWSFDD PS +GGVY Sbjct: 328 KFLQIPYLEGNWDASVEALLNADATQDGGNAMDLWSFDDVPSLMGGVY 375 >XP_009794756.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Nicotiana sylvestris] Length = 375 Score = 84.0 bits (206), Expect = 6e-16 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KFLQ+PYL+G+WDAS++A LN D TQDGGN+M+LWSFDD PS +GGVY Sbjct: 328 KFLQIPYLEGNWDASVEALLNADATQDGGNAMDLWSFDDVPSLMGGVY 375 >AFV09846.1 ethylene-responsive transcription factor, partial [Morus alba] Length = 63 Score = 77.4 bits (189), Expect = 7e-16 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDF 405 KF QMPYL+GSWDA LD FL GD+TQDGGNS+NLWSFDDF Sbjct: 16 KFFQMPYLEGSWDALLDTFLAGDSTQDGGNSINLWSFDDF 55 >CBI35806.3 unnamed protein product, partial [Vitis vinifera] Length = 108 Score = 78.6 bits (192), Expect = 8e-16 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 K+ Q+PYLDG+W+AS+DA L+GD QDGGN M+LWSFDD P+ +GGV+ Sbjct: 61 KYFQIPYLDGNWEASMDALLSGDAAQDGGNPMDLWSFDDLPTVVGGVF 108 >XP_014513131.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Vigna radiata var. radiata] Length = 96 Score = 78.2 bits (191), Expect = 8e-16 Identities = 36/49 (73%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = -2 Query: 524 KFLQMPYLDGSWD-ASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KF QMPYL+GSWD +SLD+FL+ D TQDGGN MNLWSFDD PS GGV+ Sbjct: 48 KFFQMPYLEGSWDDSSLDSFLSCDTTQDGGNLMNLWSFDDNPSMAGGVF 96 >AAX84670.1 ethylene response factor [Manihot esculenta] OAY53269.1 hypothetical protein MANES_04G150100 [Manihot esculenta] OAY53270.1 hypothetical protein MANES_04G150100 [Manihot esculenta] Length = 381 Score = 82.8 bits (203), Expect = 2e-15 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 515 QMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 QMPYL+GSW+ASLD FLNGD TQDGGN M+LWSFDD P+ +GGVY Sbjct: 337 QMPYLEGSWEASLDGFLNGDVTQDGGNPMDLWSFDDLPNMVGGVY 381 >XP_008380747.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like isoform X1 [Malus domestica] Length = 386 Score = 82.8 bits (203), Expect = 2e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 K+ Q PYLD SWDAS+DAFLNGD TQDGGN M+LWSFDD P+ +GGV+ Sbjct: 339 KYFQTPYLDESWDASVDAFLNGDATQDGGNPMDLWSFDDLPAIVGGVF 386 >NP_001280975.1 ethylene-responsive transcription factor RAP2-12-like [Malus domestica] ADE41148.1 AP2 domain class transcription factor [Malus domestica] Length = 386 Score = 82.8 bits (203), Expect = 2e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 K+ Q PYLD SWDAS+DAFLNGD TQDGGN M+LWSFDD P+ +GGV+ Sbjct: 339 KYFQTPYLDESWDASVDAFLNGDATQDGGNPMDLWSFDDLPAIVGGVF 386 >ACU19044.1 unknown [Glycine max] Length = 97 Score = 76.6 bits (187), Expect = 3e-15 Identities = 34/49 (69%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 524 KFLQMPYLDGSW-DASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 KF QMPYL+GSW D SL++ L+GD TQDGGN MNLW FDD PS GGV+ Sbjct: 49 KFFQMPYLEGSWGDTSLESLLSGDTTQDGGNLMNLWCFDDIPSMAGGVF 97 >XP_007024747.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 [Theobroma cacao] XP_017979011.1 PREDICTED: ethylene-responsive transcription factor RAP2-12 [Theobroma cacao] EOY27368.1 Transcription factor JERF1, putative isoform 1 [Theobroma cacao] EOY27369.1 Transcription factor JERF1, putative isoform 1 [Theobroma cacao] EOY27370.1 Transcription factor JERF1, putative isoform 1 [Theobroma cacao] EOY27371.1 Transcription factor JERF1, putative isoform 1 [Theobroma cacao] Length = 393 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 K+ QMP+++G+WDAS+DAFLNGD TQDGGN M+LWSFDDFP+ GV+ Sbjct: 346 KYFQMPFIEGNWDASIDAFLNGDATQDGGNPMDLWSFDDFPAMAEGVF 393 >XP_012856557.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Erythranthe guttata] EYU21280.1 hypothetical protein MIMGU_mgv1a008553mg [Erythranthe guttata] Length = 370 Score = 81.6 bits (200), Expect = 4e-15 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 K QMPYL+G+WD S+DAFLNGD TQDGGN+M+LWSFDD S L GVY Sbjct: 323 KLFQMPYLEGNWDTSIDAFLNGDATQDGGNAMDLWSFDDVTSMLDGVY 370 >XP_009357901.1 PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Pyrus x bretschneideri] Length = 386 Score = 81.6 bits (200), Expect = 4e-15 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -2 Query: 524 KFLQMPYLDGSWDASLDAFLNGDNTQDGGNSMNLWSFDDFPSTLGGVY 381 K+ Q PYLDGSWDAS+DAFLNGD TQDGGN ++LW+FDD P+ +GG + Sbjct: 339 KYFQTPYLDGSWDASVDAFLNGDATQDGGNPVDLWTFDDLPAIVGGTF 386