BLASTX nr result
ID: Phellodendron21_contig00015668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00015668 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO36792.1 hypothetical protein CISIN_1g040105mg, partial [Citru... 61 6e-10 >KDO36792.1 hypothetical protein CISIN_1g040105mg, partial [Citrus sinensis] Length = 76 Score = 61.2 bits (147), Expect = 6e-10 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 410 EPCLWGSIVWRCCQGKNHPRLFGGRAKDCEEGFEDSEGQRKASLKELD 267 E LW SIVW CQG+++ + GGR +DCEE FED E + KA LKEL+ Sbjct: 4 ESYLWWSIVWWGCQGEDNSSILGGRTEDCEESFEDPESKGKAGLKELE 51