BLASTX nr result
ID: Phellodendron21_contig00015667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00015667 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO36792.1 hypothetical protein CISIN_1g040105mg, partial [Citru... 59 5e-09 >KDO36792.1 hypothetical protein CISIN_1g040105mg, partial [Citrus sinensis] Length = 76 Score = 58.9 bits (141), Expect = 5e-09 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -2 Query: 400 EPCLWGSVVWRCCQGKNHPCLFGGRTKDCEEGLEDSEGQRQASLKELD 257 E LW S+VW CQG+++ + GGRT+DCEE ED E + +A LKEL+ Sbjct: 4 ESYLWWSIVWWGCQGEDNSSILGGRTEDCEESFEDPESKGKAGLKELE 51