BLASTX nr result
ID: Phellodendron21_contig00015578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00015578 (586 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007149070.1 hypothetical protein PHAVU_005G038500g [Phaseolus... 52 6e-06 >XP_007149070.1 hypothetical protein PHAVU_005G038500g [Phaseolus vulgaris] ESW21064.1 hypothetical protein PHAVU_005G038500g [Phaseolus vulgaris] Length = 63 Score = 52.0 bits (123), Expect = 6e-06 Identities = 30/63 (47%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -3 Query: 353 MALFSVFFGCLMPSSGST-RVSNNEGGLVVKEPSLETLXXXXXXSGAPILVPYFPTVSQF 177 M+ FS FF C +PSS S+ RVS+ E G K PS E GAPI++ YFP S Sbjct: 1 MSFFSSFFNCFVPSSSSSMRVSDVEDGCESKAPSSEKQKKKSKSKGAPIVMSYFPMNSSL 60 Query: 176 SRL 168 SRL Sbjct: 61 SRL 63