BLASTX nr result
ID: Phellodendron21_contig00014936
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014936 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444050.1 hypothetical protein CICLE_v10021263mg [Citrus cl... 70 2e-12 XP_004495198.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 70 2e-12 KHN18876.1 WD repeat-containing protein 5 [Glycine soja] 67 7e-12 KHN03803.1 WD repeat-containing protein 5 [Glycine soja] 67 8e-12 XP_018856064.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 69 8e-12 XP_003590636.1 transducin/WD40 repeat protein [Medicago truncatu... 68 2e-11 XP_019452681.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 68 2e-11 CBI28701.3 unnamed protein product, partial [Vitis vinifera] 65 2e-11 XP_012473538.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 67 2e-11 OAY61664.1 hypothetical protein MANES_01G207000 [Manihot esculenta] 67 4e-11 XP_003536561.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 67 4e-11 XP_003518920.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 67 4e-11 XP_015892074.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 66 6e-11 XP_016182940.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 66 6e-11 XP_015948400.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 66 6e-11 XP_015575611.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 66 8e-11 XP_002520730.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 66 8e-11 XP_002278415.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 65 1e-10 JAT50877.1 WD repeat-containing protein 5, partial [Anthurium am... 65 1e-10 XP_007050583.2 PREDICTED: COMPASS-like H3K4 histone methylase co... 65 1e-10 >XP_006444050.1 hypothetical protein CICLE_v10021263mg [Citrus clementina] XP_006479705.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Citrus sinensis] ESR57290.1 hypothetical protein CICLE_v10021263mg [Citrus clementina] KDO68705.1 hypothetical protein CISIN_1g021459mg [Citrus sinensis] Length = 312 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQDR 99 D+VISVTCHPTENKIASAGLDGDRTVR+WVQDR Sbjct: 280 DSVISVTCHPTENKIASAGLDGDRTVRVWVQDR 312 >XP_004495198.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Cicer arietinum] Length = 326 Score = 70.1 bits (170), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD Sbjct: 294 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 325 >KHN18876.1 WD repeat-containing protein 5 [Glycine soja] Length = 163 Score = 66.6 bits (161), Expect = 7e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGL GDRTVR+WVQD Sbjct: 131 DTVISVTCHPTENKIASAGLAGDRTVRVWVQD 162 >KHN03803.1 WD repeat-containing protein 5 [Glycine soja] Length = 172 Score = 66.6 bits (161), Expect = 8e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGL GDRTVR+WVQD Sbjct: 140 DTVISVTCHPTENKIASAGLAGDRTVRVWVQD 171 >XP_018856064.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Juglans regia] Length = 313 Score = 68.6 bits (166), Expect = 8e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGLDGDRTVRIW QD Sbjct: 281 DTVISVTCHPTENKIASAGLDGDRTVRIWAQD 312 >XP_003590636.1 transducin/WD40 repeat protein [Medicago truncatula] AES60887.1 transducin/WD40 repeat protein [Medicago truncatula] AFK38716.1 unknown [Medicago truncatula] Length = 316 Score = 67.8 bits (164), Expect = 2e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHP ENKIASAGLDGDRTVRIWVQD Sbjct: 284 DTVISVTCHPKENKIASAGLDGDRTVRIWVQD 315 >XP_019452681.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Lupinus angustifolius] XP_019452682.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Lupinus angustifolius] OIW06741.1 hypothetical protein TanjilG_11466 [Lupinus angustifolius] Length = 320 Score = 67.8 bits (164), Expect = 2e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGLD DRTVRIWVQD Sbjct: 288 DTVISVTCHPTENKIASAGLDNDRTVRIWVQD 319 >CBI28701.3 unnamed protein product, partial [Vitis vinifera] Length = 163 Score = 65.5 bits (158), Expect = 2e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISV+CHP ENKIASAGLDGD+TVRIWVQD Sbjct: 131 DTVISVSCHPNENKIASAGLDGDKTVRIWVQD 162 >XP_012473538.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Gossypium raimondii] KJB22590.1 hypothetical protein B456_004G055700 [Gossypium raimondii] Length = 317 Score = 67.4 bits (163), Expect = 2e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHP ENKIASAGLDGDRT+R+WVQD Sbjct: 285 DTVISVTCHPVENKIASAGLDGDRTIRVWVQD 316 >OAY61664.1 hypothetical protein MANES_01G207000 [Manihot esculenta] Length = 314 Score = 66.6 bits (161), Expect = 4e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGLDGDRT+++W QD Sbjct: 282 DTVISVTCHPTENKIASAGLDGDRTIKVWTQD 313 >XP_003536561.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Glycine max] KRH32024.1 hypothetical protein GLYMA_10G027100 [Glycine max] Length = 319 Score = 66.6 bits (161), Expect = 4e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGL GDRTVR+WVQD Sbjct: 287 DTVISVTCHPTENKIASAGLAGDRTVRVWVQD 318 >XP_003518920.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Glycine max] KRH71413.1 hypothetical protein GLYMA_02G146800 [Glycine max] Length = 320 Score = 66.6 bits (161), Expect = 4e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGL GDRTVR+WVQD Sbjct: 288 DTVISVTCHPTENKIASAGLAGDRTVRVWVQD 319 >XP_015892074.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Ziziphus jujuba] Length = 314 Score = 66.2 bits (160), Expect = 6e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISV CHP ENKIASAGLDGDRTVRIWVQD Sbjct: 282 DTVISVACHPVENKIASAGLDGDRTVRIWVQD 313 >XP_016182940.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] XP_016182941.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] XP_016182942.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] XP_016182943.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] Length = 319 Score = 66.2 bits (160), Expect = 6e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISV+CHPTENKIASAGLD DRTVRIWVQD Sbjct: 287 DTVISVSCHPTENKIASAGLDNDRTVRIWVQD 318 >XP_015948400.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] XP_015948401.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] XP_015948402.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] XP_015948403.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] Length = 319 Score = 66.2 bits (160), Expect = 6e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISV+CHPTENKIASAGLD DRTVRIWVQD Sbjct: 287 DTVISVSCHPTENKIASAGLDNDRTVRIWVQD 318 >XP_015575611.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B isoform X2 [Ricinus communis] Length = 317 Score = 65.9 bits (159), Expect = 8e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGLD DRT+++WVQD Sbjct: 285 DTVISVTCHPTENKIASAGLDADRTIKVWVQD 316 >XP_002520730.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B isoform X1 [Ricinus communis] EEF41692.1 WD-repeat protein, putative [Ricinus communis] Length = 318 Score = 65.9 bits (159), Expect = 8e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHPTENKIASAGLD DRT+++WVQD Sbjct: 286 DTVISVTCHPTENKIASAGLDADRTIKVWVQD 317 >XP_002278415.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Vitis vinifera] XP_010651970.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Vitis vinifera] XP_010651971.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Vitis vinifera] Length = 315 Score = 65.5 bits (158), Expect = 1e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISV+CHP ENKIASAGLDGD+TVRIWVQD Sbjct: 283 DTVISVSCHPNENKIASAGLDGDKTVRIWVQD 314 >JAT50877.1 WD repeat-containing protein 5, partial [Anthurium amnicola] Length = 316 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTV+SV+CHPTENKIASAGLD DRT+RIWVQD Sbjct: 283 DTVVSVSCHPTENKIASAGLDNDRTIRIWVQD 314 >XP_007050583.2 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Theobroma cacao] Length = 317 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 DTVISVTCHPTENKIASAGLDGDRTVRIWVQD 96 DTVISVTCHP+ENKIASAGL+GDRT+RIW+QD Sbjct: 285 DTVISVTCHPSENKIASAGLEGDRTIRIWMQD 316