BLASTX nr result
ID: Phellodendron21_contig00014926
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014926 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413467.1 hypothetical protein MELLADRAFT_56941 [Melampsora... 64 2e-09 >XP_007413467.1 hypothetical protein MELLADRAFT_56941 [Melampsora larici-populina 98AG31] EGG03332.1 hypothetical protein MELLADRAFT_56941 [Melampsora larici-populina 98AG31] Length = 444 Score = 63.5 bits (153), Expect = 2e-09 Identities = 36/88 (40%), Positives = 45/88 (51%) Frame = -3 Query: 368 VRKGQDPERETKFLISEMGKPEMIXXXXXXXXXXXXXXXXXXXXXXXXXXXLTIKLSGLP 189 VR Q+ +ETKF I EMGKP M+ L+IKLSGLP Sbjct: 232 VRNDQELGKETKFSICEMGKPHMVTSHSVVPSSASYSSILSHLFSLSLFSNLSIKLSGLP 291 Query: 188 LLMDRALVTQACAYYDRYKRPYQSTGFT 105 LL+D L A YYDR +RPY ++G+T Sbjct: 292 LLIDLELAKGASTYYDRCRRPYHASGYT 319