BLASTX nr result
ID: Phellodendron21_contig00014734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014734 (412 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006387307.1 hypothetical protein POPTR_1298s002003g, partial ... 60 1e-08 XP_016575672.1 PREDICTED: uncharacterized protein LOC107873358 i... 62 2e-08 EEF41613.1 conserved hypothetical protein [Ricinus communis] 60 6e-08 AAW56876.1 unknown protein [Oryza sativa Japonica Group] 60 7e-08 KDO67613.1 hypothetical protein CISIN_1g011452mg [Citrus sinensis] 60 7e-08 KDO67612.1 hypothetical protein CISIN_1g011452mg [Citrus sinensis] 60 7e-08 OMP14236.1 hypothetical protein COLO4_00147 [Corchorus olitorius] 60 8e-08 XP_018833515.1 PREDICTED: uncharacterized protein LOC109000917 i... 60 8e-08 XP_016499354.1 PREDICTED: uncharacterized protein LOC107817972 [... 60 9e-08 XP_015080250.1 PREDICTED: uncharacterized protein LOC107023918 i... 60 9e-08 XP_010322110.1 PREDICTED: uncharacterized protein LOC101246351 i... 60 9e-08 KDO67611.1 hypothetical protein CISIN_1g011452mg [Citrus sinensis] 60 9e-08 EEE64131.1 hypothetical protein OsJ_18963 [Oryza sativa Japonica... 60 9e-08 XP_010939878.1 PREDICTED: uncharacterized protein LOC105058601 i... 60 9e-08 KHN46185.1 hypothetical protein glysoja_039909, partial [Glycine... 60 9e-08 KHN40006.1 hypothetical protein glysoja_009383 [Glycine soja] 60 9e-08 XP_006654554.2 PREDICTED: uncharacterized protein LOC102703307 [... 60 9e-08 XP_008804635.1 PREDICTED: uncharacterized protein LOC103717871 i... 60 9e-08 KVI04346.1 hypothetical protein Ccrd_017343 [Cynara cardunculus ... 60 9e-08 XP_002520904.2 PREDICTED: uncharacterized protein LOC8276642 iso... 60 9e-08 >XP_006387307.1 hypothetical protein POPTR_1298s002003g, partial [Populus trichocarpa] ERP46221.1 hypothetical protein POPTR_1298s002003g, partial [Populus trichocarpa] Length = 152 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 22 DGTVLKSFNHLLHRNKKVDFIEQFNEK 48 >XP_016575672.1 PREDICTED: uncharacterized protein LOC107873358 isoform X3 [Capsicum annuum] Length = 461 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEKHTDSPYIRAASYLLPSNF 278 DGTVLKSFNHLLHRNKKVDFIEQFNEK + A ++ PS F Sbjct: 260 DGTVLKSFNHLLHRNKKVDFIEQFNEK----LLVSRAEFMTPSAF 300 >EEF41613.1 conserved hypothetical protein [Ricinus communis] Length = 282 Score = 59.7 bits (143), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 65 DGTVLKSFNHLLHRNKKVDFIEQFNEK 91 >AAW56876.1 unknown protein [Oryza sativa Japonica Group] Length = 309 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 256 DGTVLKSFNHLLHRNKKVDFIEQFNEK 282 >KDO67613.1 hypothetical protein CISIN_1g011452mg [Citrus sinensis] Length = 322 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 266 DGTVLKSFNHLLHRNKKVDFIEQFNEK 292 >KDO67612.1 hypothetical protein CISIN_1g011452mg [Citrus sinensis] Length = 323 Score = 59.7 bits (143), Expect = 7e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 266 DGTVLKSFNHLLHRNKKVDFIEQFNEK 292 >OMP14236.1 hypothetical protein COLO4_00147 [Corchorus olitorius] Length = 378 Score = 59.7 bits (143), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 232 DGTVLKSFNHLLHRNKKVDFIEQFNEK 258 >XP_018833515.1 PREDICTED: uncharacterized protein LOC109000917 isoform X3 [Juglans regia] Length = 399 Score = 59.7 bits (143), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 180 DGTVLKSFNHLLHRNKKVDFIEQFNEK 206 >XP_016499354.1 PREDICTED: uncharacterized protein LOC107817972 [Nicotiana tabacum] Length = 401 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 180 DGTVLKSFNHLLHRNKKVDFIEQFNEK 206 >XP_015080250.1 PREDICTED: uncharacterized protein LOC107023918 isoform X3 [Solanum pennellii] Length = 401 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 180 DGTVLKSFNHLLHRNKKVDFIEQFNEK 206 >XP_010322110.1 PREDICTED: uncharacterized protein LOC101246351 isoform X2 [Solanum lycopersicum] Length = 401 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 180 DGTVLKSFNHLLHRNKKVDFIEQFNEK 206 >KDO67611.1 hypothetical protein CISIN_1g011452mg [Citrus sinensis] Length = 411 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 266 DGTVLKSFNHLLHRNKKVDFIEQFNEK 292 >EEE64131.1 hypothetical protein OsJ_18963 [Oryza sativa Japonica Group] Length = 412 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 206 DGTVLKSFNHLLHRNKKVDFIEQFNEK 232 >XP_010939878.1 PREDICTED: uncharacterized protein LOC105058601 isoform X2 [Elaeis guineensis] Length = 416 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 268 DGTVLKSFNHLLHRNKKVDFIEQFNEK 294 >KHN46185.1 hypothetical protein glysoja_039909, partial [Glycine soja] Length = 417 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 197 DGTVLKSFNHLLHRNKKVDFIEQFNEK 223 >KHN40006.1 hypothetical protein glysoja_009383 [Glycine soja] Length = 426 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 207 DGTVLKSFNHLLHRNKKVDFIEQFNEK 233 >XP_006654554.2 PREDICTED: uncharacterized protein LOC102703307 [Oryza brachyantha] Length = 435 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 236 DGTVLKSFNHLLHRNKKVDFIEQFNEK 262 >XP_008804635.1 PREDICTED: uncharacterized protein LOC103717871 isoform X2 [Phoenix dactylifera] Length = 445 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 246 DGTVLKSFNHLLHRNKKVDFIEQFNEK 272 >KVI04346.1 hypothetical protein Ccrd_017343 [Cynara cardunculus var. scolymus] Length = 448 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 274 DGTVLKSFNHLLHRNKKVDFIEQFNEK 300 >XP_002520904.2 PREDICTED: uncharacterized protein LOC8276642 isoform X3 [Ricinus communis] Length = 451 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 412 DGTVLKSFNHLLHRNKKVDFIEQFNEK 332 DGTVLKSFNHLLHRNKKVDFIEQFNEK Sbjct: 234 DGTVLKSFNHLLHRNKKVDFIEQFNEK 260