BLASTX nr result
ID: Phellodendron21_contig00014535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014535 (694 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO51506.1 hypothetical protein CISIN_1g0351381mg [Citrus sinensis] 137 1e-38 XP_006477861.1 PREDICTED: mitochondrial import receptor subunit ... 137 1e-38 XP_006442420.1 hypothetical protein CICLE_v10023194mg [Citrus cl... 136 4e-38 XP_017980579.1 PREDICTED: mitochondrial import receptor subunit ... 126 3e-34 XP_006434603.1 hypothetical protein CICLE_v10003057mg [Citrus cl... 124 3e-33 XP_015384248.1 PREDICTED: mitochondrial import receptor subunit ... 122 2e-32 XP_012463735.1 PREDICTED: mitochondrial import receptor subunit ... 120 6e-32 XP_016675737.1 PREDICTED: mitochondrial import receptor subunit ... 119 2e-31 XP_012079254.1 PREDICTED: mitochondrial import receptor subunit ... 118 4e-31 XP_017410704.1 PREDICTED: mitochondrial import receptor subunit ... 118 5e-31 OMO88291.1 Mitochondrial import receptor [Corchorus capsularis] 117 7e-31 OMO80594.1 Mitochondrial import receptor subunit TOM7 [Corchorus... 117 1e-30 XP_014508006.1 PREDICTED: mitochondrial import receptor subunit ... 117 1e-30 XP_008391413.1 PREDICTED: mitochondrial import receptor subunit ... 117 1e-30 KYP67546.1 hypothetical protein KK1_023889 [Cajanus cajan] 117 1e-30 XP_007160221.1 hypothetical protein PHAVU_002G303100g [Phaseolus... 116 2e-30 XP_018504200.1 PREDICTED: mitochondrial import receptor subunit ... 116 2e-30 XP_015577490.1 PREDICTED: mitochondrial import receptor subunit ... 116 3e-30 OAY33764.1 hypothetical protein MANES_13G122700 [Manihot esculenta] 115 6e-30 XP_004299770.1 PREDICTED: mitochondrial import receptor subunit ... 115 8e-30 >KDO51506.1 hypothetical protein CISIN_1g0351381mg [Citrus sinensis] Length = 72 Score = 137 bits (346), Expect = 1e-38 Identities = 64/72 (88%), Positives = 70/72 (97%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 MGSRVTL+TKGK +KGAKASEEKSM +SFKEWSTWTMKKAKV+THYGFIPL+IIIGMNSD Sbjct: 1 MGSRVTLRTKGKGVKGAKASEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSD 60 Query: 355 PKPQLYQLLSPV 320 PKPQ+YQLLSPV Sbjct: 61 PKPQVYQLLSPV 72 >XP_006477861.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Citrus sinensis] Length = 72 Score = 137 bits (345), Expect = 1e-38 Identities = 64/72 (88%), Positives = 70/72 (97%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 MGSRVTL+TKGK +KGAKASEEKSM +SFKEWSTWTMKKAKV+THYGFIPL+IIIGMNSD Sbjct: 1 MGSRVTLRTKGKGVKGAKASEEKSMIDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSD 60 Query: 355 PKPQLYQLLSPV 320 PKPQ+YQLLSPV Sbjct: 61 PKPQVYQLLSPV 72 >XP_006442420.1 hypothetical protein CICLE_v10023194mg [Citrus clementina] ESR55660.1 hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 136 bits (342), Expect = 4e-38 Identities = 63/72 (87%), Positives = 69/72 (95%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 MGSRVTL+TKGK +KGAK SEEKSM +SFKEWSTWTMKKAKV+THYGFIPL+IIIGMNSD Sbjct: 1 MGSRVTLRTKGKGVKGAKVSEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSD 60 Query: 355 PKPQLYQLLSPV 320 PKPQ+YQLLSPV Sbjct: 61 PKPQVYQLLSPV 72 >XP_017980579.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Theobroma cacao] Length = 72 Score = 126 bits (316), Expect = 3e-34 Identities = 59/72 (81%), Positives = 67/72 (93%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SRV+LK+KGK+ KG+K SEEKS+A FKEWSTWTMKKAKV+THYGFIPLVIIIGMNS+ Sbjct: 1 MASRVSLKSKGKAGKGSKGSEEKSIAQCFKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSE 60 Query: 355 PKPQLYQLLSPV 320 PKPQ+YQLLSPV Sbjct: 61 PKPQIYQLLSPV 72 >XP_006434603.1 hypothetical protein CICLE_v10003057mg [Citrus clementina] XP_006434604.1 hypothetical protein CICLE_v10003057mg [Citrus clementina] ESR47843.1 hypothetical protein CICLE_v10003057mg [Citrus clementina] ESR47844.1 hypothetical protein CICLE_v10003057mg [Citrus clementina] Length = 71 Score = 124 bits (310), Expect = 3e-33 Identities = 62/72 (86%), Positives = 65/72 (90%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SR+TLKTKGKS+KGAK SE KS A+ KEWSTW MKKAKVITHYGFIPLVIIIGMNSD Sbjct: 1 MSSRITLKTKGKSVKGAKDSE-KSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSD 59 Query: 355 PKPQLYQLLSPV 320 PKPQLYQLLSPV Sbjct: 60 PKPQLYQLLSPV 71 >XP_015384248.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Citrus sinensis] KDO83900.1 hypothetical protein CISIN_1g035165mg [Citrus sinensis] KDO83901.1 hypothetical protein CISIN_1g035165mg [Citrus sinensis] Length = 71 Score = 122 bits (305), Expect = 2e-32 Identities = 61/72 (84%), Positives = 65/72 (90%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SR+TLKTKGKS+KGAK SE KS A+ KEWSTW MKKAKVITHYGFIPLVIIIGMNSD Sbjct: 1 MSSRITLKTKGKSVKGAKDSE-KSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSD 59 Query: 355 PKPQLYQLLSPV 320 PKPQL+QLLSPV Sbjct: 60 PKPQLHQLLSPV 71 >XP_012463735.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] XP_012463736.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] KJB81174.1 hypothetical protein B456_013G132400 [Gossypium raimondii] KJB81175.1 hypothetical protein B456_013G132400 [Gossypium raimondii] Length = 72 Score = 120 bits (301), Expect = 6e-32 Identities = 57/72 (79%), Positives = 62/72 (86%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SRV+LKTKGK KG+K S+EKS KEWSTW MKKAKV+THYGFIPLVIIIGMNS+ Sbjct: 1 MASRVSLKTKGKGGKGSKGSDEKSTTQCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSE 60 Query: 355 PKPQLYQLLSPV 320 PKPQLYQLLSPV Sbjct: 61 PKPQLYQLLSPV 72 >XP_016675737.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] XP_016703287.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] XP_017608704.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium arboreum] KHG28073.1 Mitochondrial import receptor subunit TOM7-1 -like protein [Gossypium arboreum] Length = 72 Score = 119 bits (298), Expect = 2e-31 Identities = 56/72 (77%), Positives = 62/72 (86%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SRV+LKTKGK KG+K S++KS KEWSTW MKKAKV+THYGFIPLVIIIGMNS+ Sbjct: 1 MASRVSLKTKGKGGKGSKGSDDKSTTQCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSE 60 Query: 355 PKPQLYQLLSPV 320 PKPQLYQLLSPV Sbjct: 61 PKPQLYQLLSPV 72 >XP_012079254.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Jatropha curcas] KDP31953.1 hypothetical protein JCGZ_12414 [Jatropha curcas] Length = 74 Score = 118 bits (296), Expect = 4e-31 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 2/74 (2%) Frame = -1 Query: 535 MGSRVTLKTKGKSL--KGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMN 362 M SRV+LK+KGKS KG K EEKSMA KEWSTWTMKKAKV+THYGFIPL+IIIGMN Sbjct: 1 MASRVSLKSKGKSSSGKGNKVMEEKSMAQCLKEWSTWTMKKAKVVTHYGFIPLIIIIGMN 60 Query: 361 SDPKPQLYQLLSPV 320 S+PKPQLYQLL+PV Sbjct: 61 SEPKPQLYQLLTPV 74 >XP_017410704.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform X1 [Vigna angularis] XP_017410705.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform X2 [Vigna angularis] Length = 72 Score = 118 bits (295), Expect = 5e-31 Identities = 56/72 (77%), Positives = 63/72 (87%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SRV+LK KGKS KG+KA E++S+ S KEW+TWTM+KAKVITHYGFIPLVIIIGMNSD Sbjct: 1 MASRVSLKAKGKSSKGSKAQEDRSVCESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSD 60 Query: 355 PKPQLYQLLSPV 320 PKP L QLLSPV Sbjct: 61 PKPALSQLLSPV 72 >OMO88291.1 Mitochondrial import receptor [Corchorus capsularis] Length = 72 Score = 117 bits (294), Expect = 7e-31 Identities = 56/72 (77%), Positives = 61/72 (84%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M S+V LK KGKS KG+K SEEKS KEWSTW +KKAKV+THYGFIPLVIIIGMNS+ Sbjct: 1 MASKVALKPKGKSGKGSKGSEEKSTVQCLKEWSTWAVKKAKVVTHYGFIPLVIIIGMNSE 60 Query: 355 PKPQLYQLLSPV 320 PKPQLYQLLSPV Sbjct: 61 PKPQLYQLLSPV 72 >OMO80594.1 Mitochondrial import receptor subunit TOM7 [Corchorus olitorius] Length = 72 Score = 117 bits (293), Expect = 1e-30 Identities = 55/72 (76%), Positives = 61/72 (84%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M S++ LK KGKS KG+K SEEKS KEWSTW +KKAKV+THYGFIPLVIIIGMNS+ Sbjct: 1 MASKIALKPKGKSGKGSKGSEEKSTVQCLKEWSTWAVKKAKVVTHYGFIPLVIIIGMNSE 60 Query: 355 PKPQLYQLLSPV 320 PKPQLYQLLSPV Sbjct: 61 PKPQLYQLLSPV 72 >XP_014508006.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Vigna radiata var. radiata] Length = 72 Score = 117 bits (293), Expect = 1e-30 Identities = 55/72 (76%), Positives = 63/72 (87%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SRV+LK KGKS KG+KA E++S++ S KEW+TWTM+KAKVITHYGFIPLVIIIGMNSD Sbjct: 1 MASRVSLKAKGKSSKGSKAQEDRSLSESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSD 60 Query: 355 PKPQLYQLLSPV 320 PKP L QL SPV Sbjct: 61 PKPALSQLFSPV 72 >XP_008391413.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Malus domestica] Length = 73 Score = 117 bits (293), Expect = 1e-30 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 1/73 (1%) Frame = -1 Query: 535 MGSRVTLKTKGKS-LKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNS 359 M S+++LKTKGK+ KG+K SEE+S+A KEWSTWTMKKAKV+THYGFIPLVIIIGMNS Sbjct: 1 MASKISLKTKGKTPAKGSKGSEERSVAQFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNS 60 Query: 358 DPKPQLYQLLSPV 320 DPKPQL QLLSPV Sbjct: 61 DPKPQLSQLLSPV 73 >KYP67546.1 hypothetical protein KK1_023889 [Cajanus cajan] Length = 72 Score = 117 bits (292), Expect = 1e-30 Identities = 56/72 (77%), Positives = 63/72 (87%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SRV+LK KGKS KG+KA+EE+S + KEW+TWTM+KAKVITHYGFIPLVIIIGMNSD Sbjct: 1 MASRVSLKAKGKSSKGSKATEERSASEYLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSD 60 Query: 355 PKPQLYQLLSPV 320 PKP L QLLSPV Sbjct: 61 PKPPLSQLLSPV 72 >XP_007160221.1 hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] ESW32215.1 hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] Length = 72 Score = 116 bits (291), Expect = 2e-30 Identities = 54/72 (75%), Positives = 63/72 (87%) Frame = -1 Query: 535 MGSRVTLKTKGKSLKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNSD 356 M SR++LK KGKS KG+KA E++S++ S KEW+TWTM+KAKVITHYGFIPLVIIIGMNSD Sbjct: 1 MASRISLKAKGKSSKGSKAQEDRSVSESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSD 60 Query: 355 PKPQLYQLLSPV 320 PKP L QL SPV Sbjct: 61 PKPALSQLFSPV 72 >XP_018504200.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 116 bits (291), Expect = 2e-30 Identities = 57/73 (78%), Positives = 64/73 (87%), Gaps = 1/73 (1%) Frame = -1 Query: 535 MGSRVTLKTKGKS-LKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNS 359 M S+++LKTKGK+ KG+K SEE S+A S KEWSTW MKKAKV+THYGFIPLVIIIGMNS Sbjct: 1 MASKISLKTKGKTPAKGSKGSEEXSVAQSVKEWSTWAMKKAKVVTHYGFIPLVIIIGMNS 60 Query: 358 DPKPQLYQLLSPV 320 DPKPQL QLLSPV Sbjct: 61 DPKPQLSQLLSPV 73 >XP_015577490.1 PREDICTED: mitochondrial import receptor subunit TOM7-1 [Ricinus communis] EEF38812.1 Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 116 bits (290), Expect = 3e-30 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 3/75 (4%) Frame = -1 Query: 535 MGSRVTLKTKGKS---LKGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGM 365 M SRV+LK+KGKS KG+KA EEKS KEWSTWT+KKAKVITHYGFIPLV+IIGM Sbjct: 1 MASRVSLKSKGKSSGGAKGSKAMEEKSTIQCLKEWSTWTLKKAKVITHYGFIPLVVIIGM 60 Query: 364 NSDPKPQLYQLLSPV 320 NS+PKPQLYQLL+PV Sbjct: 61 NSEPKPQLYQLLTPV 75 >OAY33764.1 hypothetical protein MANES_13G122700 [Manihot esculenta] Length = 74 Score = 115 bits (288), Expect = 6e-30 Identities = 57/74 (77%), Positives = 62/74 (83%), Gaps = 2/74 (2%) Frame = -1 Query: 535 MGSRVTLKTKGKSL--KGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMN 362 M SRV+LK+KGKS KG+K EEKS KEWSTW MKKAKV+THYGFIPLVIIIGMN Sbjct: 1 MASRVSLKSKGKSSSGKGSKGMEEKSTTQCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMN 60 Query: 361 SDPKPQLYQLLSPV 320 S+PKPQLYQLLSPV Sbjct: 61 SEPKPQLYQLLSPV 74 >XP_004299770.1 PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 115 bits (287), Expect = 8e-30 Identities = 55/73 (75%), Positives = 64/73 (87%), Gaps = 1/73 (1%) Frame = -1 Query: 535 MGSRVTLKTKGKSL-KGAKASEEKSMANSFKEWSTWTMKKAKVITHYGFIPLVIIIGMNS 359 M SRV+LKTKGKS KG+K S+E+S+ + KEW+ WTMKKAKV+THYGFIPL+IIIGMNS Sbjct: 1 MASRVSLKTKGKSTGKGSKGSDERSITQAVKEWTNWTMKKAKVVTHYGFIPLIIIIGMNS 60 Query: 358 DPKPQLYQLLSPV 320 DPKPQL QLLSPV Sbjct: 61 DPKPQLSQLLSPV 73