BLASTX nr result
ID: Phellodendron21_contig00014451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014451 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO42352.1 hypothetical protein CISIN_1g044020mg, partial [Citru... 184 1e-53 XP_006421287.1 hypothetical protein CICLE_v10006498mg, partial [... 184 2e-53 XP_006421285.1 hypothetical protein CICLE_v10004282mg [Citrus cl... 184 2e-52 XP_015380919.1 PREDICTED: putative calcium-transporting ATPase 1... 184 4e-52 XP_006492951.1 PREDICTED: putative calcium-transporting ATPase 1... 184 4e-52 EOY09205.1 Autoinhibited Ca2+-ATPase 11 isoform 2 [Theobroma cacao] 162 2e-44 XP_017976993.1 PREDICTED: putative calcium-transporting ATPase 1... 162 2e-44 EOY09204.1 Autoinhibited Ca2+-ATPase 11 isoform 1 [Theobroma cacao] 162 2e-44 OAY40400.1 hypothetical protein MANES_09G019100 [Manihot esculenta] 161 5e-44 OAY40399.1 hypothetical protein MANES_09G019100 [Manihot esculenta] 161 5e-44 CAN61103.1 hypothetical protein VITISV_024946 [Vitis vinifera] 160 2e-43 XP_002284417.1 PREDICTED: calcium-transporting ATPase 4, plasma ... 160 2e-43 BAJ53200.1 JHL06B08.1, partial [Jatropha curcas] 157 1e-42 XP_012086212.1 PREDICTED: calcium-transporting ATPase 4, plasma ... 157 1e-42 KOM24607.1 hypothetical protein LR48_Vigan2349s000100 [Vigna ang... 146 1e-42 XP_012086210.1 PREDICTED: calcium-transporting ATPase 4, plasma ... 157 1e-42 XP_011075350.1 PREDICTED: calcium-transporting ATPase 4, plasma ... 157 2e-42 OAY43228.1 hypothetical protein MANES_08G052600 [Manihot esculenta] 157 2e-42 EEF30249.1 cation-transporting atpase plant, putative [Ricinus c... 157 2e-42 XP_015582680.1 PREDICTED: calcium-transporting ATPase 4, plasma ... 157 2e-42 >KDO42352.1 hypothetical protein CISIN_1g044020mg, partial [Citrus sinensis] Length = 563 Score = 184 bits (468), Expect = 1e-53 Identities = 90/103 (87%), Positives = 99/103 (96%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+L+ALP GG+RAFCKGASEIVLSMC+KVV D+GEPVP+SEEQ RNITDVINGF Sbjct: 346 SVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGF 405 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKDLNDS++ENNIPD+GYTLIAVVGIKDPVRP Sbjct: 406 ASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRP 448 >XP_006421287.1 hypothetical protein CICLE_v10006498mg, partial [Citrus clementina] ESR34527.1 hypothetical protein CICLE_v10006498mg, partial [Citrus clementina] Length = 603 Score = 184 bits (468), Expect = 2e-53 Identities = 90/103 (87%), Positives = 99/103 (96%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+L+ALP GG+RAFCKGASEIVLSMC+KVV D+GEPVP+SEEQ RNITDVINGF Sbjct: 357 SVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGF 416 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKDLNDS++ENNIPD+GYTLIAVVGIKDPVRP Sbjct: 417 ASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRP 459 >XP_006421285.1 hypothetical protein CICLE_v10004282mg [Citrus clementina] ESR34525.1 hypothetical protein CICLE_v10004282mg [Citrus clementina] Length = 875 Score = 184 bits (468), Expect = 2e-52 Identities = 90/103 (87%), Positives = 99/103 (96%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+L+ALP GG+RAFCKGASEIVLSMC+KVV D+GEPVP+SEEQ RNITDVINGF Sbjct: 396 SVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGF 455 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKDLNDS++ENNIPD+GYTLIAVVGIKDPVRP Sbjct: 456 ASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRP 498 >XP_015380919.1 PREDICTED: putative calcium-transporting ATPase 11, plasma membrane-type isoform X1 [Citrus sinensis] Length = 1036 Score = 184 bits (468), Expect = 4e-52 Identities = 90/103 (87%), Positives = 99/103 (96%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+L+ALP GG+RAFCKGASEIVLSMC+KVV D+GEPVP+SEEQ RNITDVINGF Sbjct: 557 SVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGF 616 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKDLNDS++ENNIPD+GYTLIAVVGIKDPVRP Sbjct: 617 ASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRP 659 >XP_006492951.1 PREDICTED: putative calcium-transporting ATPase 11, plasma membrane-type isoform X2 [Citrus sinensis] Length = 1036 Score = 184 bits (468), Expect = 4e-52 Identities = 90/103 (87%), Positives = 99/103 (96%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+L+ALP GG+RAFCKGASEIVLSMC+KVV D+GEPVP+SEEQ RNITDVINGF Sbjct: 557 SVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGF 616 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKDLNDS++ENNIPD+GYTLIAVVGIKDPVRP Sbjct: 617 ASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRP 659 >EOY09205.1 Autoinhibited Ca2+-ATPase 11 isoform 2 [Theobroma cacao] Length = 875 Score = 162 bits (411), Expect = 2e-44 Identities = 81/100 (81%), Positives = 91/100 (91%) Frame = +2 Query: 11 KKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGFASE 190 KKMS+LVALPEGGIRAFCKGA+EIVLSMC+KV GE VP+SEE+VRNITDVINGFASE Sbjct: 399 KKMSVLVALPEGGIRAFCKGAAEIVLSMCDKVADYSGELVPLSEERVRNITDVINGFASE 458 Query: 191 ALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ALRTLCLAFKD++D+ EN+IP+ YTLIAVVGIKDPVRP Sbjct: 459 ALRTLCLAFKDVDDTYPENSIPEGDYTLIAVVGIKDPVRP 498 >XP_017976993.1 PREDICTED: putative calcium-transporting ATPase 11, plasma membrane-type, partial [Theobroma cacao] Length = 986 Score = 162 bits (411), Expect = 2e-44 Identities = 81/100 (81%), Positives = 91/100 (91%) Frame = +2 Query: 11 KKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGFASE 190 KKMS+LVALPEGGIRAFCKGA+EIVLSMC+KV GE VP+SEE+VRNITDVINGFASE Sbjct: 510 KKMSVLVALPEGGIRAFCKGAAEIVLSMCDKVADYSGELVPLSEERVRNITDVINGFASE 569 Query: 191 ALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ALRTLCLAFKD++D+ EN+IP+ YTLIAVVGIKDPVRP Sbjct: 570 ALRTLCLAFKDVDDTYPENSIPEGDYTLIAVVGIKDPVRP 609 >EOY09204.1 Autoinhibited Ca2+-ATPase 11 isoform 1 [Theobroma cacao] Length = 1036 Score = 162 bits (411), Expect = 2e-44 Identities = 81/100 (81%), Positives = 91/100 (91%) Frame = +2 Query: 11 KKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGFASE 190 KKMS+LVALPEGGIRAFCKGA+EIVLSMC+KV GE VP+SEE+VRNITDVINGFASE Sbjct: 560 KKMSVLVALPEGGIRAFCKGAAEIVLSMCDKVADYSGELVPLSEERVRNITDVINGFASE 619 Query: 191 ALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ALRTLCLAFKD++D+ EN+IP+ YTLIAVVGIKDPVRP Sbjct: 620 ALRTLCLAFKDVDDTYPENSIPEGDYTLIAVVGIKDPVRP 659 >OAY40400.1 hypothetical protein MANES_09G019100 [Manihot esculenta] Length = 873 Score = 161 bits (408), Expect = 5e-44 Identities = 77/100 (77%), Positives = 91/100 (91%) Frame = +2 Query: 11 KKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGFASE 190 KKMS+LVALP+GG+RA CKGASEIVL MC+KVV D G+PV +SEEQ RN++DVINGFASE Sbjct: 399 KKMSVLVALPKGGLRASCKGASEIVLKMCDKVVDDSGKPVHLSEEQTRNVSDVINGFASE 458 Query: 191 ALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ALRTLCLAFKDL+D+ +E+ IPD GYTL+A+VGIKDPVRP Sbjct: 459 ALRTLCLAFKDLDDTCEESRIPDFGYTLVAIVGIKDPVRP 498 >OAY40399.1 hypothetical protein MANES_09G019100 [Manihot esculenta] Length = 1038 Score = 161 bits (408), Expect = 5e-44 Identities = 77/100 (77%), Positives = 91/100 (91%) Frame = +2 Query: 11 KKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGFASE 190 KKMS+LVALP+GG+RA CKGASEIVL MC+KVV D G+PV +SEEQ RN++DVINGFASE Sbjct: 564 KKMSVLVALPKGGLRASCKGASEIVLKMCDKVVDDSGKPVHLSEEQTRNVSDVINGFASE 623 Query: 191 ALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ALRTLCLAFKDL+D+ +E+ IPD GYTL+A+VGIKDPVRP Sbjct: 624 ALRTLCLAFKDLDDTCEESRIPDFGYTLVAIVGIKDPVRP 663 >CAN61103.1 hypothetical protein VITISV_024946 [Vitis vinifera] Length = 1018 Score = 160 bits (404), Expect = 2e-43 Identities = 78/103 (75%), Positives = 90/103 (87%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+LVALP+G IRAFCKGASEI+LSMC K+V DGE +P+SE Q RNITD+INGF Sbjct: 499 SVKKKMSVLVALPDGRIRAFCKGASEIILSMCNKIVNYDGESIPLSEVQERNITDIINGF 558 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKD++D ++EN+IP GYTLI VVGIKDP RP Sbjct: 559 ASEALRTLCLAFKDVDDPSNENDIPTYGYTLIMVVGIKDPTRP 601 >XP_002284417.1 PREDICTED: calcium-transporting ATPase 4, plasma membrane-type [Vitis vinifera] CBI29805.3 unnamed protein product, partial [Vitis vinifera] Length = 1033 Score = 160 bits (404), Expect = 2e-43 Identities = 78/103 (75%), Positives = 90/103 (87%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+LVALP+G IRAFCKGASEI+LSMC K+V DGE +P+SE Q RNITD+INGF Sbjct: 556 SVKKKMSVLVALPDGRIRAFCKGASEIILSMCNKIVNYDGESIPLSEVQERNITDIINGF 615 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKD++D ++EN+IP GYTLI VVGIKDP RP Sbjct: 616 ASEALRTLCLAFKDVDDPSNENDIPTYGYTLIMVVGIKDPTRP 658 >BAJ53200.1 JHL06B08.1, partial [Jatropha curcas] Length = 886 Score = 157 bits (398), Expect = 1e-42 Identities = 77/103 (74%), Positives = 93/103 (90%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+LVALP+GG+RA CKGASEIVL MC+KVV D G+ V +S EQVRNI++VIN F Sbjct: 564 SVRKKMSVLVALPDGGLRASCKGASEIVLKMCDKVVDDSGKSVHLSPEQVRNISNVINDF 623 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 A+EALRTLCLAFKDL+DS+ E++IPD+GYTL+A+VGIKDPVRP Sbjct: 624 AAEALRTLCLAFKDLDDSSRESSIPDSGYTLVAIVGIKDPVRP 666 >XP_012086212.1 PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like isoform X2 [Jatropha curcas] KDP26085.1 hypothetical protein JCGZ_21118 [Jatropha curcas] Length = 896 Score = 157 bits (398), Expect = 1e-42 Identities = 77/103 (74%), Positives = 93/103 (90%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+LVALP+GG+RA CKGASEIVL MC+KVV D G+ V +S EQVRNI++VIN F Sbjct: 404 SVRKKMSVLVALPDGGLRASCKGASEIVLKMCDKVVDDSGKSVHLSPEQVRNISNVINDF 463 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 A+EALRTLCLAFKDL+DS+ E++IPD+GYTL+A+VGIKDPVRP Sbjct: 464 AAEALRTLCLAFKDLDDSSRESSIPDSGYTLVAIVGIKDPVRP 506 >KOM24607.1 hypothetical protein LR48_Vigan2349s000100 [Vigna angularis] Length = 187 Score = 146 bits (369), Expect = 1e-42 Identities = 70/103 (67%), Positives = 84/103 (81%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+LV LP+GG+RAFCKGASEI+L MC K++ +GE V + EE N+ +IN F Sbjct: 12 SVRKKMSVLVGLPDGGVRAFCKGASEIILKMCNKIIDCNGEVVDLPEEHANNVFRIINDF 71 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKD+N+ E NIPD+GYTLIA+VGIKDPVRP Sbjct: 72 ASEALRTLCLAFKDINEMHGEANIPDSGYTLIALVGIKDPVRP 114 >XP_012086210.1 PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like isoform X1 [Jatropha curcas] XP_012086211.1 PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like isoform X1 [Jatropha curcas] Length = 1056 Score = 157 bits (398), Expect = 1e-42 Identities = 77/103 (74%), Positives = 93/103 (90%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+LVALP+GG+RA CKGASEIVL MC+KVV D G+ V +S EQVRNI++VIN F Sbjct: 564 SVRKKMSVLVALPDGGLRASCKGASEIVLKMCDKVVDDSGKSVHLSPEQVRNISNVINDF 623 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 A+EALRTLCLAFKDL+DS+ E++IPD+GYTL+A+VGIKDPVRP Sbjct: 624 AAEALRTLCLAFKDLDDSSRESSIPDSGYTLVAIVGIKDPVRP 666 >XP_011075350.1 PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like [Sesamum indicum] Length = 1055 Score = 157 bits (397), Expect = 2e-42 Identities = 77/103 (74%), Positives = 89/103 (86%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 S KKMS+LVALPEG RAFCKGASEI+L MC++V+ +GE VP+SEEQV N+ DVINGF Sbjct: 576 SEKKKMSVLVALPEGKNRAFCKGASEIILKMCDRVINANGESVPLSEEQVSNVMDVINGF 635 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 A EALRTLCLAFKD++D + EN+IPD GYTLIAVVGIKDPVRP Sbjct: 636 ACEALRTLCLAFKDIDDGSHENSIPDCGYTLIAVVGIKDPVRP 678 >OAY43228.1 hypothetical protein MANES_08G052600 [Manihot esculenta] Length = 865 Score = 157 bits (396), Expect = 2e-42 Identities = 74/103 (71%), Positives = 93/103 (90%) Frame = +2 Query: 2 SVSKKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGF 181 SV KKMS+LVALPEGG+ A CKGASEIVL+MC+KV+ D G+ +SEEQ RNI+DVINGF Sbjct: 388 SVRKKMSVLVALPEGGLWATCKGASEIVLTMCDKVIDDSGKAANLSEEQTRNISDVINGF 447 Query: 182 ASEALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVRP 310 ASEALRTLCLAFKDL+D++++++IPD GYTL+A++GIKDP+RP Sbjct: 448 ASEALRTLCLAFKDLDDNSEQSDIPDFGYTLVAIIGIKDPLRP 490 >EEF30249.1 cation-transporting atpase plant, putative [Ricinus communis] Length = 967 Score = 157 bits (396), Expect = 2e-42 Identities = 74/99 (74%), Positives = 88/99 (88%) Frame = +2 Query: 11 KKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGFASE 190 KKMS+LV LPEGG RA CKGASEIVL MC+K+V D G +P+SEEQV+N+ D+INGFASE Sbjct: 493 KKMSVLVDLPEGGSRASCKGASEIVLKMCDKIVDDSGNSIPLSEEQVKNVLDIINGFASE 552 Query: 191 ALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVR 307 ALRTLCLAFKDL+DST E++IPD GYTL+A++GIKDPVR Sbjct: 553 ALRTLCLAFKDLDDSTTESSIPDFGYTLLAIIGIKDPVR 591 >XP_015582680.1 PREDICTED: calcium-transporting ATPase 4, plasma membrane-type [Ricinus communis] Length = 1022 Score = 157 bits (396), Expect = 2e-42 Identities = 74/99 (74%), Positives = 88/99 (88%) Frame = +2 Query: 11 KKMSMLVALPEGGIRAFCKGASEIVLSMCEKVVVDDGEPVPISEEQVRNITDVINGFASE 190 KKMS+LV LPEGG RA CKGASEIVL MC+K+V D G +P+SEEQV+N+ D+INGFASE Sbjct: 548 KKMSVLVDLPEGGSRASCKGASEIVLKMCDKIVDDSGNSIPLSEEQVKNVLDIINGFASE 607 Query: 191 ALRTLCLAFKDLNDSTDENNIPDNGYTLIAVVGIKDPVR 307 ALRTLCLAFKDL+DST E++IPD GYTL+A++GIKDPVR Sbjct: 608 ALRTLCLAFKDLDDSTTESSIPDFGYTLLAIIGIKDPVR 646