BLASTX nr result
ID: Phellodendron21_contig00014371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014371 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006443869.1 hypothetical protein CICLE_v10019537mg [Citrus cl... 65 1e-09 >XP_006443869.1 hypothetical protein CICLE_v10019537mg [Citrus clementina] XP_006479560.1 PREDICTED: uncharacterized protein LOC102621395 [Citrus sinensis] ESR57109.1 hypothetical protein CICLE_v10019537mg [Citrus clementina] Length = 558 Score = 65.1 bits (157), Expect = 1e-09 Identities = 40/59 (67%), Positives = 42/59 (71%) Frame = +2 Query: 35 YAKNVVLRRRETHVSFVYCVLDWCQSQWTKGHKVEVDILKLEEAKDAPQVSSLRTEVEK 211 YAKNV LR RET+ VY VLD CQSQ TK KVE D LK E +DAPQ SSLRTEV K Sbjct: 15 YAKNV-LRGRETYGRLVYGVLDRCQSQSTKADKVEPDALK--ETEDAPQASSLRTEVGK 70