BLASTX nr result
ID: Phellodendron21_contig00014252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014252 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007410567.1 hypothetical protein MELLADRAFT_43549 [Melampsora... 56 1e-06 >XP_007410567.1 hypothetical protein MELLADRAFT_43549 [Melampsora larici-populina 98AG31] EGG06329.1 hypothetical protein MELLADRAFT_43549 [Melampsora larici-populina 98AG31] Length = 1084 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = -2 Query: 383 FAHVLPTATPPAPEDKAMIXXXXXXXXXXXXXXXXXXVPDQLAALGLNTY 234 FAHVLPTATPPAPE+KAMI VPDQLAA GLNTY Sbjct: 1034 FAHVLPTATPPAPEEKAMITIETRAKIVQLLQDLNTQVPDQLAARGLNTY 1083