BLASTX nr result
ID: Phellodendron21_contig00014246
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014246 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006448598.1 hypothetical protein CICLE_v10016066mg [Citrus cl... 100 3e-23 KDO77221.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] 98 1e-22 KDO77216.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] 98 1e-22 XP_006468577.1 PREDICTED: mitochondrial amidoxime reducing compo... 96 6e-22 XP_007013680.2 PREDICTED: mitochondrial amidoxime reducing compo... 86 8e-18 EOY31299.1 Molybdenum cofactor sulfurase family protein isoform ... 86 8e-18 EOY31300.1 Molybdenum cofactor sulfurase family protein isoform ... 86 8e-18 KJB84386.1 hypothetical protein B456_N0224002, partial [Gossypiu... 83 1e-17 KDO77220.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] 82 4e-17 XP_012466397.1 PREDICTED: mitochondrial amidoxime reducing compo... 83 4e-17 GAV75043.1 LOW QUALITY PROTEIN: MOSC domain-containing protein/M... 83 5e-17 KHG21345.1 MOSC domain-containing 2, mitochondrial [Gossypium ar... 83 5e-17 XP_017603326.1 PREDICTED: mitochondrial amidoxime reducing compo... 83 6e-17 XP_016750018.1 PREDICTED: mitochondrial amidoxime reducing compo... 83 6e-17 XP_006448597.1 hypothetical protein CICLE_v10016075mg [Citrus cl... 82 1e-16 KDO77217.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] 82 1e-16 XP_006468578.1 PREDICTED: mitochondrial amidoxime reducing compo... 82 1e-16 XP_002528139.1 PREDICTED: mitochondrial amidoxime-reducing compo... 81 3e-16 XP_011022318.1 PREDICTED: mitochondrial amidoxime reducing compo... 80 3e-16 XP_002273557.1 PREDICTED: mitochondrial amidoxime-reducing compo... 81 3e-16 >XP_006448598.1 hypothetical protein CICLE_v10016066mg [Citrus clementina] ESR61838.1 hypothetical protein CICLE_v10016066mg [Citrus clementina] Length = 304 Score = 99.8 bits (247), Expect = 3e-23 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LK+IRSD+VLRPGRKQQGKIYFGQNMVCKDNLT G GKVLKLGDPVFVL KV S Sbjct: 245 LKQIRSDKVLRPGRKQQGKIYFGQNMVCKDNLTEGNGKVLKLGDPVFVLKKVTS 298 >KDO77221.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] Length = 304 Score = 98.2 bits (243), Expect = 1e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LK+IRSD+VLRPGRKQ+GKIYFGQNMVCKDNLT G GKVLKLGDPVFVL KV S Sbjct: 245 LKQIRSDKVLRPGRKQRGKIYFGQNMVCKDNLTEGNGKVLKLGDPVFVLKKVTS 298 >KDO77216.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] Length = 305 Score = 98.2 bits (243), Expect = 1e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LK+IRSD+VLRPGRKQ+GKIYFGQNMVCKDNLT G GKVLKLGDPVFVL KV S Sbjct: 246 LKQIRSDKVLRPGRKQRGKIYFGQNMVCKDNLTEGNGKVLKLGDPVFVLKKVTS 299 >XP_006468577.1 PREDICTED: mitochondrial amidoxime reducing component 2-like [Citrus sinensis] Length = 304 Score = 96.3 bits (238), Expect = 6e-22 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LK+IRSD+VLRPGRKQ+GKIYFGQNMVCKDNLT G GKVL LGDPVFVL KV S Sbjct: 245 LKQIRSDKVLRPGRKQRGKIYFGQNMVCKDNLTEGNGKVLNLGDPVFVLKKVTS 298 >XP_007013680.2 PREDICTED: mitochondrial amidoxime reducing component 2 [Theobroma cacao] Length = 318 Score = 85.5 bits (210), Expect = 8e-18 Identities = 37/54 (68%), Positives = 49/54 (90%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LKK+RSD+VLRP +KQQGKIYFGQN+VCK++ T G+G ++K+GDP+FVL KV+S Sbjct: 259 LKKVRSDKVLRPNQKQQGKIYFGQNLVCKESFTEGKGPMVKVGDPIFVLQKVSS 312 >EOY31299.1 Molybdenum cofactor sulfurase family protein isoform 1 [Theobroma cacao] Length = 318 Score = 85.5 bits (210), Expect = 8e-18 Identities = 37/54 (68%), Positives = 49/54 (90%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LKK+RSD+VLRP +KQQGKIYFGQN+VCK++ T G+G ++K+GDP+FVL KV+S Sbjct: 259 LKKVRSDKVLRPNQKQQGKIYFGQNLVCKESFTEGKGPMVKVGDPIFVLQKVSS 312 >EOY31300.1 Molybdenum cofactor sulfurase family protein isoform 2 [Theobroma cacao] Length = 319 Score = 85.5 bits (210), Expect = 8e-18 Identities = 37/54 (68%), Positives = 49/54 (90%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LKK+RSD+VLRP +KQQGKIYFGQN+VCK++ T G+G ++K+GDP+FVL KV+S Sbjct: 260 LKKVRSDKVLRPNQKQQGKIYFGQNLVCKESFTEGKGPMVKVGDPIFVLQKVSS 313 >KJB84386.1 hypothetical protein B456_N0224002, partial [Gossypium raimondii] Length = 222 Score = 83.2 bits (204), Expect = 1e-17 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L K RSD+VLRP +KQQGKIYFGQNMVCK++LT G+ K++K+GDP+FVL KV++ Sbjct: 163 LMKYRSDKVLRPDKKQQGKIYFGQNMVCKESLTEGKAKLVKVGDPIFVLQKVST 216 >KDO77220.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] Length = 215 Score = 82.0 bits (201), Expect = 4e-17 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L++IRSD+VLRP +KQQGKIYFGQN+V KDNL+ GKVLKLGDPVFV+ KVNS Sbjct: 158 LRQIRSDKVLRPNQKQQGKIYFGQNLVWKDNLS--NGKVLKLGDPVFVMRKVNS 209 >XP_012466397.1 PREDICTED: mitochondrial amidoxime reducing component 2-like [Gossypium raimondii] Length = 281 Score = 83.2 bits (204), Expect = 4e-17 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L K RSD+VLRP +KQQGKIYFGQNMVCK++LT G+ K++K+GDP+FVL KV++ Sbjct: 222 LMKYRSDKVLRPDKKQQGKIYFGQNMVCKESLTEGKAKLVKVGDPIFVLQKVST 275 >GAV75043.1 LOW QUALITY PROTEIN: MOSC domain-containing protein/MOSC_N domain-containing protein, partial [Cephalotus follicularis] Length = 273 Score = 82.8 bits (203), Expect = 5e-17 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L K RSD+VLRP RKQQGK+YFGQN++CKD L G+G ++K+GDPVFVL KV S Sbjct: 214 LMKFRSDKVLRPNRKQQGKVYFGQNLICKDYLAEGKGNMVKVGDPVFVLNKVLS 267 >KHG21345.1 MOSC domain-containing 2, mitochondrial [Gossypium arboreum] Length = 303 Score = 83.2 bits (204), Expect = 5e-17 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L K RSD+VLRP +KQQGKIYFGQNMVCK++LT G+ K++K+GDP+FVL KV++ Sbjct: 244 LMKYRSDKVLRPDKKQQGKIYFGQNMVCKESLTEGKAKLVKVGDPIFVLQKVST 297 >XP_017603326.1 PREDICTED: mitochondrial amidoxime reducing component 2 [Gossypium arboreum] Length = 314 Score = 83.2 bits (204), Expect = 6e-17 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L K RSD+VLRP +KQQGKIYFGQNMVCK++LT G+ K++K+GDP+FVL KV++ Sbjct: 255 LMKYRSDKVLRPDKKQQGKIYFGQNMVCKESLTEGKAKLVKVGDPIFVLQKVST 308 >XP_016750018.1 PREDICTED: mitochondrial amidoxime reducing component 2-like [Gossypium hirsutum] Length = 314 Score = 83.2 bits (204), Expect = 6e-17 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L K RSD+VLRP +KQQGKIYFGQNMVCK++LT G+ K++K+GDP+FVL KV++ Sbjct: 255 LMKYRSDKVLRPDKKQQGKIYFGQNMVCKESLTEGKAKLVKVGDPIFVLQKVST 308 >XP_006448597.1 hypothetical protein CICLE_v10016075mg [Citrus clementina] ESR61837.1 hypothetical protein CICLE_v10016075mg [Citrus clementina] Length = 303 Score = 82.4 bits (202), Expect = 1e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L++IRSD+VLRP +KQQGKIYFGQN+V KDNL+ GKVLKLGDPVFV+ KVNS Sbjct: 246 LRQIRSDKVLRPNKKQQGKIYFGQNLVWKDNLS--NGKVLKLGDPVFVMRKVNS 297 >KDO77217.1 hypothetical protein CISIN_1g021930mg [Citrus sinensis] Length = 303 Score = 82.0 bits (201), Expect = 1e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L++IRSD+VLRP +KQQGKIYFGQN+V KDNL+ GKVLKLGDPVFV+ KVNS Sbjct: 246 LRQIRSDKVLRPNQKQQGKIYFGQNLVWKDNLS--NGKVLKLGDPVFVMRKVNS 297 >XP_006468578.1 PREDICTED: mitochondrial amidoxime reducing component 2-like [Citrus sinensis] Length = 303 Score = 82.0 bits (201), Expect = 1e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L++IRSD+VLRP +KQQGKIYFGQN+V KDNL+ GKVLKLGDPVFV+ KVNS Sbjct: 246 LRQIRSDKVLRPNQKQQGKIYFGQNLVWKDNLS--NGKVLKLGDPVFVMRKVNS 297 >XP_002528139.1 PREDICTED: mitochondrial amidoxime-reducing component 1 [Ricinus communis] EEF34230.1 molybdopterin cofactor sulfurase, putative [Ricinus communis] Length = 304 Score = 81.3 bits (199), Expect = 3e-16 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L KIRSD VLRP +KQQGKIYFGQN+V KDNL G+G ++KLGDPVFV+ V+S Sbjct: 245 LMKIRSDNVLRPSKKQQGKIYFGQNLVWKDNLNGGKGNIVKLGDPVFVVKNVSS 298 >XP_011022318.1 PREDICTED: mitochondrial amidoxime reducing component 2-like isoform X2 [Populus euphratica] Length = 254 Score = 80.5 bits (197), Expect = 3e-16 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 L KIRSD+VLRP +KQQGKIYFGQN+V KDN + G GK++K+GDPVFV KV+S Sbjct: 195 LMKIRSDRVLRPDKKQQGKIYFGQNLVWKDNPSEGHGKIVKVGDPVFVHKKVSS 248 >XP_002273557.1 PREDICTED: mitochondrial amidoxime-reducing component 1 [Vitis vinifera] CBI27234.3 unnamed protein product, partial [Vitis vinifera] Length = 311 Score = 81.3 bits (199), Expect = 3e-16 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -2 Query: 298 LKKIRSDQVLRPGRKQQGKIYFGQNMVCKDNLTRGQGKVLKLGDPVFVLGKVNS 137 LK+ RSD+VLRP +KQQGK+YFGQN+VCKD+LT+G+GK + +GD V+VL K +S Sbjct: 252 LKEFRSDKVLRPNKKQQGKVYFGQNLVCKDSLTQGKGKAISVGDCVYVLSKASS 305