BLASTX nr result
ID: Phellodendron21_contig00014165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014165 (997 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007403997.1 hypothetical protein MELLADRAFT_76324 [Melampsora... 59 1e-06 >XP_007403997.1 hypothetical protein MELLADRAFT_76324 [Melampsora larici-populina 98AG31] EGG13059.1 hypothetical protein MELLADRAFT_76324 [Melampsora larici-populina 98AG31] Length = 234 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/41 (60%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 88 VQVEDED-DHLTDQDGFFGDFCLMCGDRCKGSDAFCSSNCQ 207 ++ ED+D + +DQDGFFGDFCLMCG RC G A+CS+ CQ Sbjct: 24 LETEDKDVQYESDQDGFFGDFCLMCGIRCLGGHAYCSTYCQ 64