BLASTX nr result
ID: Phellodendron21_contig00014068
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00014068 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415761.1 hypothetical protein MELLADRAFT_92878 [Melampsora... 66 5e-10 >XP_007415761.1 hypothetical protein MELLADRAFT_92878 [Melampsora larici-populina 98AG31] EGG00913.1 hypothetical protein MELLADRAFT_92878 [Melampsora larici-populina 98AG31] Length = 440 Score = 66.2 bits (160), Expect = 5e-10 Identities = 48/129 (37%), Positives = 67/129 (51%), Gaps = 27/129 (20%) Frame = +1 Query: 97 TSSPATTPALHSPRL-VISRVPVPVL---------------DHLHDPTTLVPTAPDLTLI 228 + +P TT ++ S R I PVP+ D+L +P TL+PT PDLTL Sbjct: 18 SDTPITTSSILSRRRDSIISAPVPIKLQLVKDTPSNNIGESDYLQNPNTLLPTVPDLTLN 77 Query: 229 LPQTPTNQLSSVFS-TPAPSLALDIDTTPLSISFS----------EDRPPCPNSIKPGGD 375 P+TP + S PAPSL L+ DTTPLS+S S E + +SI+ GG+ Sbjct: 78 PPRTPESSSHPTLSFEPAPSLILNFDTTPLSMSISKKENYQPEGYEPKQHSMDSIRIGGN 137 Query: 376 ELSDVNNQK 402 + S VN++K Sbjct: 138 QPSGVNDRK 146