BLASTX nr result
ID: Phellodendron21_contig00013636
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00013636 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016691624.1 PREDICTED: 40S ribosomal protein S29-like [Gossyp... 94 1e-23 KNA05754.1 hypothetical protein SOVF_187480 [Spinacia oleracea] ... 94 1e-23 XP_010679081.1 PREDICTED: 40S ribosomal protein S29 [Beta vulgar... 94 1e-23 XP_016675090.1 PREDICTED: 40S ribosomal protein S29-like [Gossyp... 94 1e-23 XP_007042613.1 PREDICTED: 40S ribosomal protein S29 [Theobroma c... 94 1e-23 XP_006474714.1 PREDICTED: 40S ribosomal protein S29 [Citrus sine... 94 2e-23 XP_016721989.1 PREDICTED: 40S ribosomal protein S29-like [Gossyp... 93 4e-23 NP_001294917.1 uncharacterized protein LOC544138 [Solanum lycope... 93 6e-23 XP_004250423.1 PREDICTED: 40S ribosomal protein S29 [Solanum lyc... 93 6e-23 XP_010272246.1 PREDICTED: 40S ribosomal protein S29 [Nelumbo nuc... 92 1e-22 XP_015938948.1 PREDICTED: 40S ribosomal protein S29-like [Arachi... 91 2e-22 XP_015892835.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus ju... 91 2e-22 ABK93131.1 unknown [Populus trichocarpa] 91 2e-22 ABK93425.1 unknown [Populus trichocarpa] 91 2e-22 KCW68667.1 hypothetical protein EUGRSUZ_F02264, partial [Eucalyp... 92 2e-22 XP_018827642.1 PREDICTED: 40S ribosomal protein S29-like [Juglan... 92 3e-22 XP_017700341.1 PREDICTED: 40S ribosomal protein S29 [Phoenix dac... 91 3e-22 XP_017697823.1 PREDICTED: 40S ribosomal protein S29-like [Phoeni... 91 3e-22 XP_017643970.1 PREDICTED: 40S ribosomal protein S29 [Gossypium a... 91 5e-22 XP_016177446.1 PREDICTED: 40S ribosomal protein S29-like [Arachi... 91 5e-22 >XP_016691624.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium hirsutum] Length = 56 Score = 94.4 bits (233), Expect = 1e-23 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >KNA05754.1 hypothetical protein SOVF_187480 [Spinacia oleracea] KNA21216.1 hypothetical protein SOVF_044700 [Spinacia oleracea] KNA23766.1 hypothetical protein SOVF_022300 [Spinacia oleracea] Length = 56 Score = 94.4 bits (233), Expect = 1e-23 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_010679081.1 PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] XP_010679083.1 PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] XP_010681497.1 PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] KMT08336.1 hypothetical protein BVRB_6g141600 [Beta vulgaris subsp. vulgaris] KMT10198.1 hypothetical protein BVRB_5g119590 [Beta vulgaris subsp. vulgaris] KMT10199.1 hypothetical protein BVRB_5g119600 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 94.4 bits (233), Expect = 1e-23 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_016675090.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium hirsutum] XP_017643650.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium arboreum] KHG00104.1 40S ribosomal S29 -like protein [Gossypium arboreum] Length = 56 Score = 94.4 bits (233), Expect = 1e-23 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_007042613.1 PREDICTED: 40S ribosomal protein S29 [Theobroma cacao] XP_012450812.1 PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] XP_012480164.1 PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] XP_012436123.1 PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] XP_012460836.1 PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] XP_012465209.1 PREDICTED: 40S ribosomal protein S29 [Gossypium raimondii] XP_016715574.1 PREDICTED: 40S ribosomal protein S29 [Gossypium hirsutum] XP_016732639.1 PREDICTED: 40S ribosomal protein S29 [Gossypium hirsutum] XP_016666559.1 PREDICTED: 40S ribosomal protein S29 [Gossypium hirsutum] XP_016679827.1 PREDICTED: 40S ribosomal protein S29 [Gossypium hirsutum] XP_016734500.1 PREDICTED: 40S ribosomal protein S29 [Gossypium hirsutum] XP_017614248.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium arboreum] AFK35122.1 unknown [Lotus japonicus] EOX98444.1 Ribosomal protein S14p/S29e family protein [Theobroma cacao] KHG07764.1 40S ribosomal S29 -like protein [Gossypium arboreum] KJB12288.1 hypothetical protein B456_002G010100 [Gossypium raimondii] KJB32273.1 hypothetical protein B456_005G232700 [Gossypium raimondii] KJB77639.1 hypothetical protein B456_012G148100 [Gossypium raimondii] KJB79436.1 hypothetical protein B456_013G049700 [Gossypium raimondii] OMO63340.1 Ribosomal protein S14 [Corchorus olitorius] Length = 56 Score = 94.4 bits (233), Expect = 1e-23 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_006474714.1 PREDICTED: 40S ribosomal protein S29 [Citrus sinensis] XP_006486933.1 PREDICTED: 40S ribosomal protein S29 [Citrus sinensis] KDO73880.1 hypothetical protein CISIN_1g037282mg [Citrus sinensis] Length = 56 Score = 94.0 bits (232), Expect = 2e-23 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGF+KYR Sbjct: 16 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVKYR 56 >XP_016721989.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium hirsutum] XP_016727077.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium hirsutum] XP_017636515.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium arboreum] XP_017639632.1 PREDICTED: 40S ribosomal protein S29-like [Gossypium arboreum] Length = 56 Score = 93.2 bits (230), Expect = 4e-23 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR+CRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRSCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >NP_001294917.1 uncharacterized protein LOC544138 [Solanum lycopersicum] XP_006347277.1 PREDICTED: 40S ribosomal protein S29 [Solanum tuberosum] XP_006350329.1 PREDICTED: 40S ribosomal protein S29 [Solanum tuberosum] XP_009626362.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] XP_009591987.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] XP_009759838.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] XP_009776080.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] XP_015080098.1 PREDICTED: 40S ribosomal protein S29 [Solanum pennellii] XP_015056910.1 PREDICTED: 40S ribosomal protein S29 [Solanum pennellii] XP_016444810.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana tabacum] XP_016472894.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana tabacum] XP_016476273.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana tabacum] XP_016515436.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana tabacum] XP_016578047.1 PREDICTED: 40S ribosomal protein S29 [Capsicum annuum] XP_019263176.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana attenuata] XP_019240806.1 PREDICTED: 40S ribosomal protein S29 [Nicotiana attenuata] Length = 56 Score = 92.8 bits (229), Expect = 6e-23 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR CRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRTCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_004250423.1 PREDICTED: 40S ribosomal protein S29 [Solanum lycopersicum] Length = 56 Score = 92.8 bits (229), Expect = 6e-23 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR CRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRTCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_010272246.1 PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] XP_010261813.1 PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] XP_010277082.1 PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] XP_012093101.1 PREDICTED: 40S ribosomal protein S29 [Jatropha curcas] XP_017697791.1 PREDICTED: 40S ribosomal protein S29 [Phoenix dactylifera] XP_018852113.1 PREDICTED: 40S ribosomal protein S29 [Juglans regia] XP_019711246.1 PREDICTED: 40S ribosomal protein S29 [Elaeis guineensis] XP_019710635.1 PREDICTED: 40S ribosomal protein S29 [Elaeis guineensis] OAY39261.1 hypothetical protein MANES_10G080500 [Manihot esculenta] Length = 56 Score = 92.0 bits (227), Expect = 1e-22 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRACRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_015938948.1 PREDICTED: 40S ribosomal protein S29-like [Arachis duranensis] Length = 56 Score = 91.3 bits (225), Expect = 2e-22 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR CRVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_015892835.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] XP_015866899.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] Length = 56 Score = 91.3 bits (225), Expect = 2e-22 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR CRVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ABK93131.1 unknown [Populus trichocarpa] Length = 56 Score = 91.3 bits (225), Expect = 2e-22 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR CRVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ABK93425.1 unknown [Populus trichocarpa] Length = 56 Score = 91.3 bits (225), Expect = 2e-22 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR CRVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >KCW68667.1 hypothetical protein EUGRSUZ_F02264, partial [Eucalyptus grandis] Length = 83 Score = 92.0 bits (227), Expect = 2e-22 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 43 PGSRACRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 83 >XP_018827642.1 PREDICTED: 40S ribosomal protein S29-like [Juglans regia] Length = 92 Score = 92.0 bits (227), Expect = 3e-22 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 52 PGSRACRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 92 >XP_017700341.1 PREDICTED: 40S ribosomal protein S29 [Phoenix dactylifera] XP_017702531.1 PREDICTED: 40S ribosomal protein S29 isoform X1 [Phoenix dactylifera] XP_019701871.1 PREDICTED: 40S ribosomal protein S29 [Elaeis guineensis] XP_019704954.1 PREDICTED: 40S ribosomal protein S29 [Elaeis guineensis] Length = 56 Score = 90.9 bits (224), Expect = 3e-22 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPH +IRKYGLMCCRQCFRSNAK+IGFIKYR Sbjct: 16 PGSRACRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR 56 >XP_017697823.1 PREDICTED: 40S ribosomal protein S29-like [Phoenix dactylifera] Length = 56 Score = 90.9 bits (224), Expect = 3e-22 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGNPH +IRKYGLMCCRQCFRSN+KEIGFIKYR Sbjct: 16 PGSRACRVCGNPHGLIRKYGLMCCRQCFRSNSKEIGFIKYR 56 >XP_017643970.1 PREDICTED: 40S ribosomal protein S29 [Gossypium arboreum] Length = 56 Score = 90.5 bits (223), Expect = 5e-22 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSRACRVCGN HAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRACRVCGNLHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >XP_016177446.1 PREDICTED: 40S ribosomal protein S29-like [Arachis ipaensis] Length = 56 Score = 90.5 bits (223), Expect = 5e-22 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 325 PGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 203 PGSR CRVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 16 PGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56