BLASTX nr result
ID: Phellodendron21_contig00013597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00013597 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006422277.1 hypothetical protein CICLE_v10004181mg [Citrus cl... 76 2e-13 XP_006422275.1 hypothetical protein CICLE_v10004181mg [Citrus cl... 76 2e-13 OAY30174.1 hypothetical protein MANES_14G010100 [Manihot esculenta] 60 1e-07 GAV73501.1 PB1 domain-containing protein/Pkinase_Tyr domain-cont... 59 3e-07 >XP_006422277.1 hypothetical protein CICLE_v10004181mg [Citrus clementina] ESR35517.1 hypothetical protein CICLE_v10004181mg [Citrus clementina] Length = 1118 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 299 MEHSRIHQQYQYSSMEPRNGEFQPPSQAYMLDPTSSVNPNMMP 427 ME SRIHQQYQ+++MEP N EFQPPSQ YMLDPTSS+NPN++P Sbjct: 1 MEQSRIHQQYQHNAMEPGNLEFQPPSQVYMLDPTSSINPNVIP 43 >XP_006422275.1 hypothetical protein CICLE_v10004181mg [Citrus clementina] XP_006422276.1 hypothetical protein CICLE_v10004181mg [Citrus clementina] XP_006493761.1 PREDICTED: uncharacterized protein LOC102629157 [Citrus sinensis] ESR35515.1 hypothetical protein CICLE_v10004181mg [Citrus clementina] ESR35516.1 hypothetical protein CICLE_v10004181mg [Citrus clementina] Length = 1179 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 299 MEHSRIHQQYQYSSMEPRNGEFQPPSQAYMLDPTSSVNPNMMP 427 ME SRIHQQYQ+++MEP N EFQPPSQ YMLDPTSS+NPN++P Sbjct: 1 MEQSRIHQQYQHNAMEPGNLEFQPPSQVYMLDPTSSINPNVIP 43 >OAY30174.1 hypothetical protein MANES_14G010100 [Manihot esculenta] Length = 1041 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +2 Query: 287 NNIVMEHSRIHQQYQYSSMEPRNGEFQPPSQAYMLDPTSSVNPNM 421 NNI MEHS IH+Q+QYSS E + F P SQA+MLDP SS N NM Sbjct: 6 NNIAMEHSDIHKQFQYSSRESGHEGFPPASQAFMLDPRSSRNNNM 50 >GAV73501.1 PB1 domain-containing protein/Pkinase_Tyr domain-containing protein [Cephalotus follicularis] Length = 1245 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +2 Query: 287 NNIVMEHSRIHQQYQYSSMEPRNGEFQPPSQAYMLDPTSSVNPNMMP 427 +NIVME SR H+Q QY+S++P N + P SQA+ML+P SS+N +M P Sbjct: 6 SNIVMEQSRTHKQIQYNSIDPGNEQIHPASQAFMLNPVSSMNLSMRP 52