BLASTX nr result
ID: Phellodendron21_contig00013534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00013534 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414105.1 hypothetical protein MELLADRAFT_109941 [Melampsor... 65 1e-09 XP_003307058.1 hypothetical protein PGTG_00008 [Puccinia gramini... 54 9e-06 >XP_007414105.1 hypothetical protein MELLADRAFT_109941 [Melampsora larici-populina 98AG31] EGG02703.1 hypothetical protein MELLADRAFT_109941 [Melampsora larici-populina 98AG31] Length = 1138 Score = 64.7 bits (156), Expect = 1e-09 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 155 MSSWPLKKSPSPTSDMVLSEGLSSPFR-DIPLNSLSSPYHVIDISPSPPPP 6 MSS PL SP + EGLSSPFR D+P N+LSSPYHVIDISPSPPPP Sbjct: 1 MSSLPLNASPLAVEVAPVVEGLSSPFRVDLP-NTLSSPYHVIDISPSPPPP 50 >XP_003307058.1 hypothetical protein PGTG_00008 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP74052.1 hypothetical protein PGTG_00008 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 1086 Score = 53.5 bits (127), Expect = 9e-06 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -3 Query: 155 MSSWPLKKSPSPTSDMVLSEGLSSPFRDIPLNSLSSPYHVIDISPSPPPPA 3 M + L + S + + +GLSSPFRD P +SL+ HVIDISPSPPPPA Sbjct: 1 MKTSMLLSAESTPTRFISVKGLSSPFRDQPASSLTVSSHVIDISPSPPPPA 51