BLASTX nr result
ID: Phellodendron21_contig00012952
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00012952 (681 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNF01284.1 ribosomal protein L37ae [Puccinia striiformis f. sp. ... 112 1e-28 XP_003338060.1 60S ribosomal protein L43 [Puccinia graminis f. s... 112 1e-28 XP_007407421.1 hypothetical protein MELLADRAFT_34532 [Melampsora... 109 1e-27 KZP30620.1 ribosomal protein L37ae [Fibulorhizoctonia sp. CBS 10... 110 1e-27 KDQ06121.1 hypothetical protein BOTBODRAFT_141296 [Botryobasidiu... 109 2e-27 XP_007261656.1 60S ribosomal protein L37 [Fomitiporia mediterran... 109 2e-27 XP_007407923.1 hypothetical protein MELLADRAFT_84341 [Melampsora... 109 2e-27 CUA78336.1 60S ribosomal protein L37a [Dictyostelium discoideum]... 108 3e-27 CEL56213.1 60S ribosomal protein L37a OS=Dictyostelium discoideu... 108 3e-27 KZW00052.1 60S ribosomal protein L37 [Exidia glandulosa HHB12029] 108 4e-27 KII87453.1 hypothetical protein PLICRDRAFT_255768 [Plicaturopsis... 108 4e-27 KNZ74603.1 60S ribosomal protein L37a, partial [Termitomyces sp.... 108 6e-27 KDQ27074.1 hypothetical protein PLEOSDRAFT_1077820 [Pleurotus os... 108 6e-27 KZS94319.1 ribosomal protein L37ae [Sistotremastrum niveocremeum... 107 9e-27 KDQ61704.1 hypothetical protein JAAARDRAFT_31164 [Jaapia argilla... 107 9e-27 KIY68876.1 60S ribosomal protein L43 [Cylindrobasidium torrendii... 107 1e-26 EUC55686.1 60S ribosomal protein L37 [Rhizoctonia solani AG-3 Rh... 107 1e-26 XP_009549138.1 hypothetical protein HETIRDRAFT_387068 [Heterobas... 107 1e-26 XP_007320794.1 hypothetical protein SERLADRAFT_472821 [Serpula l... 107 1e-26 XP_016607688.1 60S ribosomal protein L37a [Spizellomyces punctat... 107 2e-26 >KNF01284.1 ribosomal protein L37ae [Puccinia striiformis f. sp. tritici PST-78] KNZ62068.1 ribosomal protein L37a [Puccinia sorghi] OAV99652.1 ribosomal protein L37ae [Puccinia triticina 1-1 BBBD Race 1] Length = 92 Score = 112 bits (280), Expect = 1e-28 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQIKKME+TQHARYTCTFCGKDTVKR+AVGIWDC+SCRKVIAGGAW Sbjct: 18 YGASLRKQIKKMEVTQHARYTCTFCGKDTVKRSAVGIWDCRSCRKVIAGGAW 69 >XP_003338060.1 60S ribosomal protein L43 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] XP_003337730.2 60S ribosomal protein L43 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP93641.1 ribosomal protein L37ae [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP93311.2 ribosomal protein L37ae [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 92 Score = 112 bits (280), Expect = 1e-28 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQIKKME+TQHARYTCTFCGKDTVKR+AVGIWDC+SCRKVIAGGAW Sbjct: 18 YGASLRKQIKKMEVTQHARYTCTFCGKDTVKRSAVGIWDCRSCRKVIAGGAW 69 >XP_007407421.1 hypothetical protein MELLADRAFT_34532 [Melampsora larici-populina 98AG31] EGG09061.1 hypothetical protein MELLADRAFT_34532, partial [Melampsora larici-populina 98AG31] Length = 76 Score = 109 bits (273), Expect = 1e-27 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQIKKMEITQHARYTCTFCGKD+VKRTAVGIW+CK+CRK IAGGAW Sbjct: 2 YGASLRKQIKKMEITQHARYTCTFCGKDSVKRTAVGIWECKACRKTIAGGAW 53 >KZP30620.1 ribosomal protein L37ae [Fibulorhizoctonia sp. CBS 109695] Length = 92 Score = 110 bits (274), Expect = 1e-27 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKDTVKRTAVGIW+C SC+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDTVKRTAVGIWNCSSCKKVIAGGAW 69 >KDQ06121.1 hypothetical protein BOTBODRAFT_141296 [Botryobasidium botryosum FD-172 SS1] Length = 92 Score = 109 bits (273), Expect = 2e-27 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKRTAVGIW C+SCRKVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRTAVGIWKCRSCRKVIAGGAW 69 >XP_007261656.1 60S ribosomal protein L37 [Fomitiporia mediterranea MF3/22] EJD07704.1 60S ribosomal protein L37 [Fomitiporia mediterranea MF3/22] Length = 92 Score = 109 bits (273), Expect = 2e-27 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKRTAVGIW+C++CRKVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRTAVGIWECRACRKVIAGGAW 69 >XP_007407923.1 hypothetical protein MELLADRAFT_84341 [Melampsora larici-populina 98AG31] EGG08949.1 hypothetical protein MELLADRAFT_84341 [Melampsora larici-populina 98AG31] Length = 92 Score = 109 bits (273), Expect = 2e-27 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQIKKMEITQHARYTCTFCGKD+VKRTAVGIW+CK+CRK IAGGAW Sbjct: 18 YGASLRKQIKKMEITQHARYTCTFCGKDSVKRTAVGIWECKACRKTIAGGAW 69 >CUA78336.1 60S ribosomal protein L37a [Dictyostelium discoideum] [Rhizoctonia solani] Length = 92 Score = 108 bits (271), Expect = 3e-27 Identities = 46/52 (88%), Positives = 52/52 (100%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKME+TQHARYTCTFCGKD+VKRTAVGIW+C+SC+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEVTQHARYTCTFCGKDSVKRTAVGIWNCRSCKKVIAGGAW 69 >CEL56213.1 60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1 [Rhizoctonia solani AG-1 IB] Length = 92 Score = 108 bits (271), Expect = 3e-27 Identities = 46/52 (88%), Positives = 52/52 (100%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKME+TQHARYTCTFCGKD+VKRTAVGIW+C+SC+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEVTQHARYTCTFCGKDSVKRTAVGIWNCRSCKKVIAGGAW 69 >KZW00052.1 60S ribosomal protein L37 [Exidia glandulosa HHB12029] Length = 92 Score = 108 bits (270), Expect = 4e-27 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKRTAVGIW C+SC+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRTAVGIWKCRSCKKVIAGGAW 69 >KII87453.1 hypothetical protein PLICRDRAFT_255768 [Plicaturopsis crispa FD-325 SS-3] Length = 92 Score = 108 bits (270), Expect = 4e-27 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKRTAVGIW+C SC+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRTAVGIWNCSSCKKVIAGGAW 69 >KNZ74603.1 60S ribosomal protein L37a, partial [Termitomyces sp. J132] Length = 92 Score = 108 bits (269), Expect = 6e-27 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEI+QHARYTCTFCGKD+VKRTAVGIW+C SCRKVIAGGAW Sbjct: 18 YGASLRKQVKKMEISQHARYTCTFCGKDSVKRTAVGIWNCSSCRKVIAGGAW 69 >KDQ27074.1 hypothetical protein PLEOSDRAFT_1077820 [Pleurotus ostreatus PC15] Length = 92 Score = 108 bits (269), Expect = 6e-27 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEI+QHARYTCTFCGKD+VKRTAVGIW CKSC+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEISQHARYTCTFCGKDSVKRTAVGIWGCKSCKKVIAGGAW 69 >KZS94319.1 ribosomal protein L37ae [Sistotremastrum niveocremeum HHB9708] KZT39395.1 ribosomal protein L37ae [Sistotremastrum suecicum HHB10207 ss-3] Length = 92 Score = 107 bits (268), Expect = 9e-27 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKR+AVGIW+C SCRKVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRSAVGIWNCHSCRKVIAGGAW 69 >KDQ61704.1 hypothetical protein JAAARDRAFT_31164 [Jaapia argillacea MUCL 33604] Length = 92 Score = 107 bits (268), Expect = 9e-27 Identities = 46/52 (88%), Positives = 52/52 (100%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKR+AVGIW+CK+C+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRSAVGIWNCKACKKVIAGGAW 69 >KIY68876.1 60S ribosomal protein L43 [Cylindrobasidium torrendii FP15055 ss-10] Length = 92 Score = 107 bits (267), Expect = 1e-26 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEI+QHARYTCTFCGKDTVKRTAVGIW C CRKVIAGGAW Sbjct: 18 YGASLRKQVKKMEISQHARYTCTFCGKDTVKRTAVGIWKCSGCRKVIAGGAW 69 >EUC55686.1 60S ribosomal protein L37 [Rhizoctonia solani AG-3 Rhs1AP] KEP54857.1 60S ribosomal protein L37 [Rhizoctonia solani 123E] Length = 92 Score = 107 bits (267), Expect = 1e-26 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKME+TQHARYTCTFCGKD+VKR+AVGIW+C+SC+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEVTQHARYTCTFCGKDSVKRSAVGIWNCRSCKKVIAGGAW 69 >XP_009549138.1 hypothetical protein HETIRDRAFT_387068 [Heterobasidion irregulare TC 32-1] ETW78839.1 hypothetical protein HETIRDRAFT_387068 [Heterobasidion irregulare TC 32-1] Length = 92 Score = 107 bits (267), Expect = 1e-26 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKR AVGIW CK+CRKVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRQAVGIWKCKACRKVIAGGAW 69 >XP_007320794.1 hypothetical protein SERLADRAFT_472821 [Serpula lacrymans var. lacrymans S7.9] EGN92256.1 hypothetical protein SERLA73DRAFT_117573 [Serpula lacrymans var. lacrymans S7.3] EGO22256.1 hypothetical protein SERLADRAFT_472821 [Serpula lacrymans var. lacrymans S7.9] Length = 92 Score = 107 bits (267), Expect = 1e-26 Identities = 46/52 (88%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHARYTCTFCGKD+VKRTAVGIW+C +C+KVIAGGAW Sbjct: 18 YGASLRKQVKKMEITQHARYTCTFCGKDSVKRTAVGIWNCSACKKVIAGGAW 69 >XP_016607688.1 60S ribosomal protein L37a [Spizellomyces punctatus DAOM BR117] KNC99648.1 60S ribosomal protein L37a [Spizellomyces punctatus DAOM BR117] Length = 92 Score = 107 bits (266), Expect = 2e-26 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = +3 Query: 114 YGASLRKQIKKMEITQHARYTCTFCGKDTVKRTAVGIWDCKSCRKVIAGGAW 269 YGASLRKQ+KKMEITQHA+YTCTFCGKD+VKRTAVGIW+C+SCRK +AGGAW Sbjct: 18 YGASLRKQVKKMEITQHAKYTCTFCGKDSVKRTAVGIWNCRSCRKTLAGGAW 69