BLASTX nr result
ID: Phellodendron21_contig00012773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00012773 (466 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015389838.1 PREDICTED: uncharacterized protein LOC107178762 [... 55 6e-06 >XP_015389838.1 PREDICTED: uncharacterized protein LOC107178762 [Citrus sinensis] Length = 580 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = +1 Query: 232 SNRCFICRKK*HFSKNCPNKPDKTAKFVEQIHQSTLL 342 S+RCFIC+KK HF+KNCPN+P K+ + +E + S LL Sbjct: 141 SSRCFICKKKGHFTKNCPNRPTKSVRLIEHLQDSMLL 177